KEGG   Camponotus floridanus (Florida carpenter ant): 105248635Help
Entry
105248635         CDS       T03919                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00052  Galactose metabolism
cfo00500  Starch and sucrose metabolism
cfo01100  Metabolic pathways
cfo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105248635
   00500 Starch and sucrose metabolism
    105248635
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105248635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfo04147]
    105248635
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105248635
Exosome [BR:cfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105248635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 105248635
NCBI-ProteinID: XP_011251836
LinkDB All DBs
Position
Unknown
AA seq 1049 aa AA seqDB search
MTHAKNGHNAPKKPKYNTVVKDYSNNIVTEIDNCKIMMPNKESYNLTRKNHETEALNSLE
NNNNENDNNANSIRMKQIMIILSFACVMILFLCHLSFPILSMITNSMLTTMNDYSVKIQF
TIFIPNNTDKKTEYQDILVDTFDTHIEQQKYDYKVVPLRKENLFEQNTFNNTQQCTNIPE
ILRFDCHPEDGASQLSCTNRGCCWNSIDRNKITGHVPLAIPYCYYPQDWNLYKYINQSKD
GSDFLGFLKQEKKSPYKNDVPLVKIEATSIDSSILRVKMYDPLKNRYEPPWPIRSNPKPF
LSKITNTTYQFNSDNVKPGFKVDRVSDGTTLFNSIGIGGFIFADQFLQITTLLPTNNIYG
IGEHRSSLKLNTNWQSFTLFNKDQPPTENANLYGSHPFYIVVENSGMAHGVLFLNSNAMD
VILQPTPAITFRTIGGIFDIYFFLGPTPADVVKQYSEIVGKPFMPPYWSLGFHLCRFGYR
TLEETKAVWNRTRAAGIPFDTQWNDLDYMDKNNDFTYNKEKFKDLPKFIEEIHSVGMHYI
PLIDAGISASEKNGSYPPYDEGIKQDIFIKDGITSKPFVGKVWNSVSTVWPDFTNPETME
YYANMMGNMHDSFAYDGAWIDMNEPSNFYNGHKNGCVYNHLDFPEYLPNVVGDLLATKTL
CMNAKHYLGSHYDLHNTYGISQAISTNYALRKIRQKRPFIISRSTWVGHGHYAGHWTGDI
YSTWHDLRMGIPAILTLNFYQIPMVGEDICGFNGNTTIALCNRWMQLGAFYPFSRNHNSD
DTIEQDPVAMGDLVVQSSKSALKIRYRLLPYLYTLFFRAHRFGETVARPLFFEFIDDLKT
YDIDTQFLWGSALMINPVLEENKTNIDVYVPYGLWYDYYSLDSFFSFGTYHTLYAPIDKI
PLLIRGGSILPAQKPGATTTESRENNFELIVSLNEAGNAKGELYWDDGDSIDSIRKEEYL
WLSFTANTSSLLNIKMDGSFFNKEVILGKVQILGIEEQVSQVFLNQNEIGFKYEPYTASL
SIIDLQVDMRQLFVFYWFYEEEYSDIESL
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgactcatgcaaaaaatgggcacaatgcccctaaaaaaccaaagtataatacagtggtt
aaagattactcgaacaatattgtgacagaaattgataattgtaagattatgatgccgaac
aaagaatcttacaacttaacgagaaaaaatcatgaaacagaagcattaaactctcttgaa
aataataacaatgagaatgataataatgcaaatagtataagaatgaagcaaataatgata
atattatcctttgcgtgtgtcatgattttatttttatgtcatctcagttttccaattttg
tctatgattacaaattcaatgctcaccaccatgaatgattatagtgtaaaaatacagttt
acaatttttatacctaacaatactgacaaaaagacagagtaccaggatatattagtggat
acttttgatactcacattgaacaacaaaagtatgattataaagtagtacctttaaggaaa
gaaaatttatttgaacaaaacacgtttaataatactcaacaatgcaccaatattcctgaa
atattacgctttgattgtcatccagaggatggagcatcgcaactttcctgtacaaataga
ggatgttgttggaattctattgacagaaataaaattacaggacatgtgccacttgctatt
ccttattgttattatcctcaggattggaatctgtataaatatattaatcagagtaaagat
ggtagtgacttcttaggttttctcaagcaagagaaaaaatctccttataagaatgatgtc
cctcttgtaaagatagaggctacaagtatagacagttcaatcctgcgtgtaaaaatgtat
gatcccttgaaaaaccgatatgaaccaccatggccaattagatcaaacccaaaaccattt
ttatctaaaattaccaacacaacatatcaatttaacagtgataatgtaaaacctgggttt
aaggtcgacagagttagtgatggaacaacattatttaattccattgggattggaggtttc
atatttgctgatcaatttctgcaaataactacattattaccaacaaataatatttatggt
attggtgaacacagatcaagtttaaaattaaatactaattggcaatcatttactttattc
aacaaagatcaaccaccaacagaaaatgcaaatttatatggatctcatccattttatatt
gttgtggaaaattctggaatggctcatggagttttatttttaaacagtaacgctatggat
gtgatattgcagcctacgccggctataacatttaggacaattggtggtattttcgatata
tattttttcttgggaccaactccagctgatgttgtaaaacaatattctgagattgtgggt
aaaccattcatgccaccttattggtctcttggcttccacttatgcagatttggatataga
accttagaagaaactaaagcagtttggaacagaacaagagcagctggaattccatttgat
actcaatggaatgatttggattacatggacaaaaacaatgactttacatacaataaagag
aaatttaaagatttgcctaaatttatagaagaaattcattcagtaggaatgcactacatt
cctttaatagatgctggtatatccgcttccgaaaaaaatggttcttatccaccatacgac
gagggaataaaacaggatatattcataaaagacggtataacgtctaaaccttttgttggc
aaagtctggaattcagtctccacggtgtggcccgattttacaaatcctgaaacgatggaa
tattatgcaaatatgatgggcaatatgcacgacagttttgcatatgatggtgcatggatt
gatatgaatgaaccatccaacttctataatggtcataaaaacggttgtgtgtataatcat
ctggattttcccgaatatttacccaatgttgtcggagatttgctcgctacaaagactttg
tgcatgaatgcaaaacattatttaggatctcattatgatcttcacaatacttatggaata
agtcaagcgatttccacaaattatgccctcaggaaaatcagacagaagagaccatttata
atttcgcgttcgacgtgggtaggacacggtcattatgctggccattggacgggtgacatt
tattcaacatggcatgatttaagaatgggcattccagccattttgaccctcaatttctat
caaattccaatggtgggcgaggacatttgcggttttaatggaaacacgactatagcattg
tgcaatcgctggatgcaacttggtgctttctatccattctctcgaaatcataattcagac
gatacaattgaacaggatccagttgcaatgggagacttggttgtacaatcgtcaaagagc
gctctcaaaatacgttatcgacttttaccatatttatatactttattcttcagagcacat
agattcggtgaaacagtggcacgtccattattttttgagtttatcgatgatctaaaaact
tacgacattgatacgcaatttctttggggaagtgcgcttatgattaatccagttcttgaa
gaaaataaaactaatatagatgtttatgtaccatatggcctatggtatgattattatagt
ctcgattccttcttttcctttggaacatatcatacattatatgcaccaatcgataaaata
ccattattgattcgtggaggctcgattcttccagcacagaagccgggtgcaacaaccaca
gaaagcagagaaaataattttgaattgatagtatcattaaatgaagctgggaatgccaaa
ggagaactgtattgggatgatggtgatagtatagattccataagaaaggaggaatatttg
tggttatctttcactgcaaacacatccagcttactcaacattaaaatggatggctctttt
tttaataaagaggtgattcttgggaaagttcagattttgggaatagaggaacaagtgtcc
caagtatttctaaatcagaatgagataggatttaaatacgagccttatacagcaagtctg
agtatcattgacctgcaagtggacatgagacaattatttgtattttattggttttatgaa
gaagaatacagtgacatagaatctctctga

DBGET integrated database retrieval system