KEGG   Camponotus floridanus (Florida carpenter ant): 105249468
Entry
105249468         CDS       T03919                                 

Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfo04052]
    105249468
   00536 Glycosaminoglycan binding proteins [BR:cfo00536]
    105249468
Cytokines and growth factors [BR:cfo04052]
 Growth factors
  Growth factors (RTK binding)
   105249468
Glycosaminoglycan binding proteins [BR:cfo00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   105249468
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 105249468
NCBI-ProteinID: XP_011253276
UniProt: E2A856
LinkDB
Position
Unknown
AA seq 235 aa
MSLRWIHENLEAPTCDEECSDIDDSCSDDSYDTELSLQEDDDVVENGKKIARDVRKKRET
KRPSTTTVTFDGNGTPRNMERNSKPHKYTPYVIWDPRQPAKNPVYNCGIIKLYCRTGYHL
AITPSGRVRGLSDNKESHALLHVTPVSFGVIRIQSIETRLYLAFNKKGRLYGEVNMSNDN
TEWEQWTIGSYDAFRSRKYVHYGWWIGIKKNGRAKPGPKTSWGQKAIQFSAIQED
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagtttgcgctggattcacgagaatttggaagcaccaacatgcgacgaggagtgcagc
gatatcgacgatagttgcagtgacgatagctacgacacggaattatctcttcaggaagac
gacgatgtagtagaaaatgggaagaaaatcgctcgcgatgttcggaagaagagggaaacc
aaaagaccttcgaccacgaccgtcacctttgacgggaacggaaccccgcgtaacatggaa
cgcaactccaaaccacataaatatacgccgtacgtaatatgggatccccgacagccagcg
aaaaatcctgtctataattgtgggataataaaactgtactgtcgaacagggtatcatctg
gcaattacaccatcgggacgagtccgaggattatctgacaacaaagagtcgcacgctctg
cttcacgtaacaccggtatctttcggtgttattagaatacaaagtatcgaaacgaggctc
tatctggcatttaataaaaaaggacgattatacggagaggtaaatatgagcaacgataat
actgaatgggaacaatggactattggttcctatgatgcatttcgatcgcgcaaatacgtg
cattatggatggtggataggaataaagaagaatggacgagcaaagccgggaccgaaaaca
tcttgggggcaaaaagcaatacaattttcggctatccaagaggattaa

DBGET integrated database retrieval system