KEGG   Camponotus floridanus (Florida carpenter ant): 105249732Help
Entry
105249732         CDS       T03919                                 

Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfo01009]
    105249732
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cfo03019]
    105249732
   04131 Membrane trafficking [BR:cfo04131]
    105249732
   03036 Chromosome and associated proteins [BR:cfo03036]
    105249732
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105249732
Protein phosphatases and associated proteins [BR:cfo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105249732
Messenger RNA biogenesis [BR:cfo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     105249732
Membrane trafficking [BR:cfo04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    105249732
Chromosome and associated proteins [BR:cfo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     105249732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var
Motif
Other DBs
NCBI-GeneID: 105249732
NCBI-ProteinID: XP_025261716
LinkDB All DBs
Position
Unknown
AA seq 1173 aa AA seqDB search
MTEPIVRSDLFTAAKQLADSEIELIKVIESSSKCQRSTTNMFESVKKTKKPGKSKNVVRP
SAALLAAKREAAQRQLLLNKKSNNSFIRDVYQNAIDAYKIVRKETGLVFDRSMAEHECLW
DPNYPECPARFTRVLQRCEELNLVQRCKRVESRLATENEILTKHSQKQIDILKATDGCAD
SENLELLSSKYDAVFVHPSTYKLSLLAVGSTINLVESICKGEIQNGMAIIRPPGHHAMKS
EYCGYCFFNNVAIAVEKALSSNLANRILIVDWDVHHGQATQQMFYNDPRVVYFSIHRYEY
GEFWPNLKESDFHYIGEDLGEGYNFNIPLNKTGMTNADYIAIFQQVLLPMAYEFQPDLII
VSAGYDAALGCPEGEMLITPACYSHLLSSLLSLAAGKVAVILEGGYCLKSLAEGAALTLR
TLLGDPCPILQTLDLPSSSIRDTILNVIYAHKPYWKCYQYQEMHSINSITHNKEEIANRH
VVMVTYKGNDFKPDKYETRNCYPKQSKEVLEVIDKKLNELILLTRLHKAPHKVCIVYDEK
MQKHCNISDNIHPEKPSRISSIYNNHEKYGLLERCHLLQGRSATLAELSLAHSKDYIDSI
KRTSTLKPKELQKQASDYNSVYLHNETWSSACVSAGCLLKMVDAVLNGESQSGIAIVRPP
GHHAEEDNACGFCIFNNVAIAAQYAVQFHHLKRVLIVDWDVHHGNGTQSIFEEDPKILYI
SVHRYDNGSFFPNSKRANYTSVGLNAGEGFNVNIPWNKKGMGDAEYIAVFQQVVMPIAYQ
FNPELILVSAGFDACVGDPLGGCLVSPELYGHLIHWLSSLANGRIILSLEGGYNINSISH
AMTMCTKALLGDPLPMLDSGLIPCSSAVNSINNVLKTHKKFWPNLQYGMSLPKEKLLPKL
KKTLNKLDEQGRITEKPKQTESKIALEVIESEKLELNLAIDKNRLNLVTDEEILKLTNEV
ENIKIKNSELRPTRSATDETRRNSGLKKSEMKKLDASQSIQKCVNETNQSKDNQQGGSRI
PEDRDDEGAASLQRETQSTTLLEYLSDNLQALTAGEMFAVVPLRDCPHLFTVNEVPPSGI
DVTLPCMECASTAENWICLQCYTVHCARSINQHAMQHAEECEHPITLSFSDISVWCYGCE
AYIDNPRLYAARNAAHQSKFNEELPWTYNENDI
NT seq 3522 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcctatagtgaggtcagatttgttcactgctgctaaacaattagcagacagt
gaaattgaactaataaaagtaatcgaaagttccagcaagtgccaaagatctactacaaat
atgtttgagagtgttaagaaaacaaagaagcctggaaaatcaaaaaatgtagttcgtcca
tcagctgcactgttggctgccaaacgagaggcagctcaacgacagctgctgttgaataaa
aaatccaacaatagtttcatacgagatgtatatcaaaatgcaattgacgcgtacaaaata
gtacgaaaggagactggtcttgtatttgatcgaagcatggcagagcatgaatgcctctgg
gatccaaattatcctgaatgtccggctagatttacacgagttttgcaaagatgtgaagaa
ctgaatttggtgcaaagatgtaagcgcgtcgaatcaagattggctacagaaaatgagatc
ctgacaaagcacagtcagaaacaaattgatatcttgaaggcaacagatggctgtgcagat
tctgagaatttggaattgctttcttccaaatatgatgctgtctttgttcatccatctaca
tataaattatctttactagctgtgggctcaacaatcaatttagtggaaagtatctgtaaa
ggcgaaattcaaaatggtatggctatcattaggccaccgggtcatcatgccatgaaatca
gagtactgtggttactgctttttcaacaatgtggctattgcagtagagaaagctttgagc
tctaatttggcgaatagaattttaattgtggattgggatgttcatcatggacaagcaacg
caacaaatgttttacaatgatccacgtgtagtctatttttctatacatcgttatgaatat
ggagaattctggcccaatctaaaggaatctgactttcattatattggagaggatcttgga
gagggttataactttaatatacccttaaataagactggtatgactaatgctgattacatc
gcgatcttccaacaagttttattgccaatggcttacgaatttcaaccagatcttataata
gtatcagctggttatgatgcagctctaggttgtccagagggagagatgttaataactcca
gcgtgttattctcatttactatcatcgttattaagtctggcagctggaaaagtcgccgta
attttagagggtggttattgcttgaaatctttagcagaaggtgcagcattgactttaaga
actttattgggtgatccatgccctattttacaaacacttgacttgccatcatcaagtata
cgtgacactattctgaatgtaatctatgcacacaaaccatattggaaatgttatcaatac
caagaaatgcatagtatcaatagcataacacataacaaggaggaaattgctaatagacat
gtagttatggttacatacaaaggcaacgattttaaaccagataaatatgaaactcgaaat
tgctatcctaaacaaagcaaagaagttttggaagtcatcgataaaaaattaaatgaattg
atattacttacaaggttacataaggcgcctcacaaagtgtgtatcgtttatgatgaaaaa
atgcagaagcattgcaatatctctgacaatatccatccagagaaaccatctcgcatctct
agcatttataataatcatgaaaagtatggcctgttggaacggtgtcatttgctgcaagga
aggagtgcgacactagcagaattatccttggctcattcaaaggattacattgatagtatc
aaaaggacttcgactttaaaacctaaggaattgcagaagcaagcgtcggattataattcc
gtttatcttcacaatgaaacgtggtcaagtgcctgcgtgtctgccggctgccttttaaaa
atggtggacgcggttttaaatggagaaagtcaatccggaatagccattgtgagaccacca
ggacatcatgctgaggaagataatgcatgcggtttttgtatctttaacaatgtggctata
gctgcgcaatatgccgtacagtttcatcatttaaagagagtgttaatagtggattgggac
gtgcatcatggtaatgggacgcaatccatctttgaagaagatcccaaaattctttatatt
tctgtacatcgttatgataatgggagctttttcccaaattccaagcgagctaattatacg
agcgttggcttaaacgcaggcgaaggattcaatgtaaacataccgtggaacaaaaaagga
atgggagacgctgaatacatagcagtttttcagcaagtcgtgatgcccattgcttatcag
tttaatccagaactgattttggtttctgctggatttgatgcttgtgtgggtgatccactc
ggaggttgcctggtaagtccggagctctatggccatttgatccattggctttcgtccctg
gccaacggccgcataatcctcagtcttgaaggaggctacaacatcaactccatttctcat
gcgatgaccatgtgcaccaaggctctcttgggcgatccgctgcccatgctggattccggt
ttgatcccctgctctagcgcagttaattccatcaataacgtgttgaaaactcacaagaaa
ttctggcctaatctgcaatatggaatgtccttgccgaaggaaaaactgctccccaaactc
aagaaaactctgaacaagcttgacgaacaaggaagaatcacagaaaagccaaaacaaacg
gaatcgaaaattgctttagaagtaatcgaaagtgagaaattggaattgaacttggcgatc
gataagaatcgtttgaacctggtgacggatgaagaaattctaaagttgacaaatgaagtg
gagaatattaaaattaagaactctgaattgcgtccgacgagaagcgcaacggatgagact
aggagaaattctggattgaaaaagagcgaaatgaaaaaattggatgcttcgcagagtata
cagaaatgcgtaaacgaaacgaatcaatcgaaagacaatcaacaaggaggttctcgtata
cccgaggatcgcgatgacgaaggcgcagcatctctacaacgtgaaacacaatcgacgact
cttctagagtatctctccgataatcttcaggctctgacagcgggagaaatgttcgcggtg
gtacctctgcgagattgtccgcacttatttacagtcaacgaagttcctcccagtggaatt
gatgtaactttaccttgcatggagtgcgccagcaccgcggagaattggatctgcttacaa
tgttacaccgtacattgcgctcgcagtatcaatcaacacgcaatgcaacacgcagaggaa
tgcgagcatcccatcacgctcagtttcagcgacatctccgtttggtgctatggttgcgaa
gcttatattgataatcctagattatacgcggcaagaaacgcagctcatcaaagcaaattc
aatgaagagcttccctggacttataacgaaaatgacatataa

DBGET integrated database retrieval system