KEGG   Camponotus floridanus (Florida carpenter ant): 105250951
Entry
105250951         CDS       T03919                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo04013  MAPK signaling pathway - fly
cfo04214  Apoptosis - fly
cfo04215  Apoptosis - multiple species
cfo04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105250951
   04391 Hippo signaling pathway - fly
    105250951
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105250951
   04215 Apoptosis - multiple species
    105250951
SSDB
Motif
Pfam: TNFR_c6 Trp_oprn_chp CD225 HCO3_cotransp
Other DBs
NCBI-GeneID: 105250951
NCBI-ProteinID: XP_011255660
LinkDB
Position
Unknown
AA seq 321 aa
MPRESCPGLLLTLVSIFVGLCESFAAGGATSGTQQPQPQPQQQHPVCKPGLEFWSTERAS
CWPCTRCAPDFTLSPCAVHKDAICGSLELDYASGTPKWSSEAGEKAFIAKFWRLLETKQR
VSTVETGNLDQDRDDDEGSGDEKPVYSASRESKTAHDPRERRKSATEADQLPWDWQTGAL
VLAVCACIVFFLVAGCSALVYARQWRRMKKNFEPAGLEEISARLNLMVKAELAELVAGAP
MNPGDPETRCQYLEKLLDRKRETPVVTTATTATGWPEAAAGNLYIEEGSTMTPTRSKRSQ
IARIQRNIETILSHKTNQATD
NT seq 966 nt   +upstreamnt  +downstreamnt
atgccgagggaatcttgtcccgggttactattgaccctagtgtcgatattcgtcggtctg
tgcgagtccttcgccgccggcggcgcgacatccggcacccagcagccgcagccgcagccg
cagcagcaacatccggtctgcaagcccggtctggagttctggtcgaccgaacgtgcctcc
tgctggccatgcacccgatgcgcccccgacttcaccctgagcccttgcgcggtgcacaag
gacgcgatatgcggctcgctcgagctcgactacgcatccgggacgcccaaatggtcgtcg
gaggccggcgagaaggccttcatcgccaagttctggcggctcctcgagacgaaacaacgg
gtttccacggtggaaaccggaaatctcgaccaagatcgagatgacgacgaaggctccggc
gatgagaagccggtctattccgcctcgcgggaatccaagacggcacacgatcctcgggaa
aggagaaaatcggctaccgaggccgatcaattaccgtgggattggcagaccggcgccttg
gtcctcgcggtgtgtgcttgcatagtgttcttcctggtagcgggttgctcggctcttgtt
tacgcgaggcaatggcggagaatgaagaaaaattttgagccagcgggtcttgaggagatc
tcagccagattgaatctgatggtgaaggcggagctggccgagctggttgcaggggcgccg
atgaacccaggtgatcccgaaaccagatgtcagtatcttgagaagcttttagaccggaaa
cgggagactccggtggtgacgacggcaacgacagcgactggctggccggaggcggcggcc
ggcaacttgtacattgaagaggggagcacgatgacgccgacgaggagtaagcgatcgcag
atcgcgcggattcagcgcaacatcgaaaccattctcagtcacaagacgaatcaggccact
gactga

DBGET integrated database retrieval system