KEGG   Camponotus floridanus (Florida carpenter ant): 105252156Help
Entry
105252156         CDS       T03919                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    105252156
Enzymes [BR:cfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     105252156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored EF-hand_7 EF-hand_6 Pyr_redox_2 GIDA EF-hand_1 FAD_binding_3 HI0933_like NAD_binding_8 EF-hand_9 EF-hand_8 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 105252156
NCBI-ProteinID: XP_011257748
LinkDB All DBs
Position
Unknown
AA seq 718 aa AA seqDB search
MASLRLFVAGASAIGAGTLTSHFLLSDNTVHAEKGKPRPPRRTLPTRESQVKTLKSQEYD
VLIIGGGATGAGCALDACTRGLKTALVEADDFASGTSSRSTKLIHGGVRYLQKAIMQLDI
EQYRMVKEALHERASMLQSAPHLAHPLPIMLPVYTWWQIPYYWFGIKMYDLVAGSKTVKS
SYYLSKSNALELFPMLKGDKLTGAIVYYDGQQDDARMNLAIALTASRHGATVVNHVKVVN
LLKGLDKDGKRVLVGAHLKDELTGEEWDVKAKAIINATGPFTDHIRKMDDQNVESICAPS
SGVHIVLPGYYSPDQMGLLDPATSDGRVIFFLPWQKQTIAGTTDLPCEVTHNPRPTEDEI
MFILQEVKNYLNPDVEVRRGDVLSAWSGIRPLVSDPNKPNTQSLARNHIVHVSPTNLVTI
AGGKWTTYRAMAQETIDATIKACDLQPERSCQTDGFLLEGAQGWSPTMYIRLVQDFGLEC
EVAQHLSKSYGDRAFAVAKMASLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDM
IARRLRLAFLNVQAAQEALPAIIDIMAEELHWSTEEKKKQHREASEFLAQEMGQMVNRAS
RDKIPINLTKDEIQLYIKRFGIIDKDKKGYVSINDIRRGLKVLGIRMNQDEMHSLLNEID
LTYNGQMELQDYLQMMSAIKSGHVAYSRFARMAEMEEAQHEKEMLKKQISVERSGGGL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacttagattatttgtagcaggagcgagtgccataggtgctggtactcttact
tcacactttcttttgtcggataatacggtacatgctgaaaaaggaaaaccaagaccgcct
cgaagaactttaccaacacgagagagtcaagtaaagactttaaagtcgcaagagtacgat
gtattaataattgggggtggtgcgacaggggcaggatgcgctctggatgcttgcacgcga
ggtttgaagactgcgctggtcgaagccgacgacttcgcatctggaacttcttcccgaagc
acaaagttaattcacggcggtgtacgatatttgcaaaaagccatcatgcagttagacatc
gagcaatatagaatggtaaaagaagcacttcacgaacgtgcgtcgatgctgcagagcgca
ccgcatttggcgcatccattacctattatgctgccagtttatacatggtggcagattcct
tattattggttcggcattaagatgtacgatttggtagcaggtagcaaaacagtgaagtcg
tcgtactatctgagtaaatcaaatgctttggaactttttccgatgctaaaaggcgacaaa
ctgacgggagctattgtctattatgacggtcagcaagatgatgctagaatgaatttggca
atcgctctgacagcttcaagacacggggcgacagttgtaaatcacgttaaagtggttaat
ctgctcaagggtctcgacaaggatggcaaacgtgtcctcgtcggtgctcaccttaaagac
gaacttacgggagaggaatgggacgtaaaggctaaggcgataatcaacgcaaccggcccc
tttaccgatcatatcagaaaaatggacgatcaaaacgttgaatctatctgcgctccgtct
tccggagttcatatagtgctaccaggatattacagtcctgaccagatgggcttactcgat
ccagcgacgagcgacggtcgcgtaatcttttttttgccgtggcaaaagcaaactatcgcg
ggaactaccgatctaccgtgtgaagtaacgcataatcctcgacccacggaagacgaaatc
atgttcatcttgcaggaagtaaaaaattatctaaatccggacgtcgaagtacgccgcggg
gacgttctctctgcctggagcggtatcagaccccttgtttccgatccgaacaaaccgaac
actcaatcgcttgccagaaatcatatcgtgcacgttagtcctacgaatctcgtcacaata
gcaggtggtaaatggacgacttatcgagccatggctcaagaaaccattgacgcaaccata
aaagcttgtgatctacaacctgaaagatcatgccagaccgatggttttcttctggaaggt
gcacagggctggagtcctacaatgtacattagattagtgcaggactttggtttagaatgc
gaagtcgcgcaacatttatccaagagttacggagatcgtgcgtttgccgtagctaaaatg
gcttctttgacagggaaacgatggccgattattggaaaaaaaattcatccggaattcccg
tatatcgatgctgagatacgttatggtgtacgagaatatgccagaaccgcgatcgatatg
atcgcgcgtcgattgagactcgctttcctcaatgtgcaagcggctcaagaggcattgcca
gccatcatagacatcatggccgaagaattgcattggtcgacagaggaaaagaagaagcaa
catcgtgaggccagtgaatttctcgcacaagaaatgggtcaaatggtgaatcgtgcttct
cgcgacaagattcccatcaatctcaccaaagacgagatccagctctacattaaacgtttt
ggaattatagacaaggacaaaaaaggatatgtctctattaatgatattagacgaggatta
aaggtattaggtataagaatgaaccaggacgagatgcacagcttgttgaatgaaattgat
cttacttacaacggtcaaatggaattacaagactatttgcagatgatgtcggctataaag
tctggtcatgtggcatactcgcgtttcgcacggatggctgaaatggaggaagcgcaacac
gaaaaagaaatgctcaaaaagcaaataagcgttgagagatcgggtggaggactatga

DBGET integrated database retrieval system