KEGG   Camponotus floridanus (Florida carpenter ant): 105252756Help
Entry
105252756         CDS       T03919                                 

Definition
(RefSeq) NF-kappa-B inhibitor cactus isoform X1
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    105252756
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfo03000]
    105252756
   04131 Membrane trafficking [BR:cfo04131]
    105252756
Transcription factors [BR:cfo03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    105252756
Membrane trafficking [BR:cfo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    105252756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3
Motif
Other DBs
NCBI-GeneID: 105252756
NCBI-ProteinID: XP_011258610
UniProt: E2AIG3
LinkDB All DBs
Position
Unknown
AA seq 464 aa AA seqDB search
MWHPSRESRSTQMEEPVTADERKRWRRDDHQDDDVDDKDKDDYEAGNVDSGFLSSGNLQF
SDEIRDSELPQQGGQSGVGDAGAGVPTPAPAAVTTTASSSATTAIAEEPMRAIDSGVDLD
LTETLSQLSLKQVSLNPLASKSGKLIQAVESASPELSPVTANLTQPDDNTKLQHDEAFLF
EQPQRESETSNEEPWQLYYTQDDDGDTQLHIAIVQGFVEAALCLIRMAPDPCLLDIINDD
WQSPLHLAVLTHQPLIVRHLILAGADPSLRNFRGNTALHLACASGDLGCAKALTDPLYPM
ERNKLTLGQQVPALPQNLEQRNYNGEMCLHLAAANGHVDLVRLLLRLGADLKAKEGLAGY
TALHLAVERECRPVFELLLPECQRTSCLDERTYRGTTAYQLTLDVYSAFAKEARRKLVRH
GAAPEPLPESDSESSEDEETERSLWTADYLPAIVKTQNTVGVTV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtggcatcccagccgcgagagtagaagcacccagatggaggaacctgttacagcggac
gagaggaagcggtggcgtcgcgacgaccaccaggacgacgacgtcgacgacaaggacaag
gacgattacgaagcgggcaacgtcgattccgggttcctgtcgagcggcaatctgcagttc
agcgacgagattcgcgactcggagttaccgcaacagggggggcagtcgggggtaggggac
gcgggggcgggggtgccgactcccgcgccagcggccgtgacgacgaccgcatcatcatcg
gcgacgacggcgatcgcggaggagccaatgagggcgatcgacagcggcgtggacctcgac
ctcaccgagaccctgagccagctcagcctgaagcaggtcagcctgaacccgctcgcctcc
aagagcggcaagttgattcaggcggtcgagtcggcgagccccgagctgtcacccgtgacc
gcgaaccttacgcaaccggacgacaacaccaagttacagcacgatgaggcgtttctgttc
gagcaaccccaacgggagagcgagaccagcaacgaggaaccctggcagctctattatacg
caggacgacgatggtgacacgcaattgcatatcgcaatcgtacaaggctttgtggaagct
gcgctctgtttaataagaatggcgcctgacccgtgcctattggacatcataaatgacgac
tggcaatcgcctttacatctggcagtgttgacgcaccaaccgctcattgtcaggcactta
atcctggcgggcgcggatccatctctaaggaatttccgtgggaacacggctctacaccta
gcttgtgcgagcggagatctcggttgcgctaaagctctcacagatccactatacccgatg
gagaggaataagctgacgctcggacaacaagtacctgccttaccacaaaacttggagcaa
cgtaattacaacggtgagatgtgcttgcacttggccgccgcaaacggacatgtggatcta
gtgcgacttctgttgcgtttaggcgccgatctcaaggcgaaggaaggtctggcaggatac
acagcccttcatctcgcggtggagcgcgaatgtcggccagtgttcgagcttctattgcca
gaatgtcaacgaacatcgtgtctggacgagcgaacgtatcgcggcacgacagcctatcaa
ttgactctggacgtctacagtgcattcgccaaggaggctcgcagaaagctggtacgacac
ggcgcggcgccggaaccactgccagagtcggattccgagagcagcgaggacgaggaaacg
gagaggtcattgtggacagcggattatttgcccgcgatcgtcaagacacaaaacacggtt
ggagtgacagtctaa

DBGET integrated database retrieval system