KEGG   Camponotus floridanus (Florida carpenter ant): 105254010Help
Entry
105254010         CDS       T03919                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00020  Citrate cycle (TCA cycle)
cfo00190  Oxidative phosphorylation
cfo01100  Metabolic pathways
cfo01200  Carbon metabolism
Module
cfo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105254010
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105254010
Enzymes [BR:cfo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105254010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like Imm45
Motif
Other DBs
NCBI-GeneID: 105254010
NCBI-ProteinID: XP_011260737
LinkDB All DBs
Position
Unknown
AA seq 661 aa AA seqDB search
MSGLLKLSASLLPRALPGTLNKLGLPLLGNRKLHHTPDGRAAKISDAISKQYPLVDHTYD
AVVVGAGGAGLRAAYGLVAEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEADNWQWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTNDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLLMEDGECRGVIAFSLEDGT
LHRFRAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRANLPNQDLEFVQFHPTGIYGA
GCLITEGSRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRSMTMEIREGRGVGPEKDH
IYLQLHHLPAEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVLT
RENNEDKVVRGLYACGEAACASVHGANRLGANSLLDLVVFGRACAKTIAQENKPGETIGS
LKPNAGEETVANLDWVRNANGSISTAELRLTMQKTMQTHAAVFREAQTLQEGYRKMIDLY
KKLDEVKVADRSLIWNSDLIETLELQNLMVNAMQTIVGAENRKESRGAHAREDYKDRIDE
YDYSKPLENQQPRPFEQHWRKHTLSKINPKTGEVSLDYRPVIDVTLDQQECATVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattgctgaagctgtcggcgtccttgctgccgagggctctgccggggacgttg
aacaagctgggattgccgctactcggcaaccggaagctgcatcacacaccggacggccga
gcggccaagatctccgacgcgatctctaaacagtatccgttggtggatcacacgtatgat
gcggtggtggtaggagccggaggtgccggtcttcgggcggcctacggcctggtggccgaa
ggcttcaaaaccgcggtggtcaccaaactgttcccgacaagatcgcacacggtagccgcc
cagggcggcatcaacgccgccctgggcaatatggaagctgacaactggcagtggcacatg
tacgacactgtcaagggctcggactggctgggcgatcaggacgccattcattacatgacg
cgtgaggcccccaaagccgtcatcgaactggagaactgcggcatgcccttcagtcgaact
aacgatggtaagatctatcaacgcgcgtttggcggtcaatcgctcaagttcggcaaaggt
ggtcaagctcaccgatgttgttgtgtggccgacagaaccggtcattccttgctgcacacg
ctctacggccagtcactgagctacgactgcaattacttcgtcgaatactttgcgcttgac
ctgctgatggaggacggcgagtgtcgtggagtgatcgcgttcagtctcgaggacggaacg
ttgcatcgcttccgcgccaagaacacggtgctcgccaccggtggctacggacgtgcttat
ttctcctgcacgtctgcgcacacctgcaccggcgatggcactgccatggtctccagggcc
aatctacccaatcaggatcttgaattcgtacaatttcaccccacaggtatctatggcgcc
ggatgtctgatcacagaaggcagccgcggcgaaggcggttatctaataaatagcgaaggt
gaaaggttcatggaacgttacgcgccggtagcgaaagatctcgcatcgcgagacgtagtg
tctagatctatgacaatggaaatcagagagggcagaggcgtcggaccggaaaaggatcat
atttacttgcagctacatcacctgccggctgaacagctggccgctcggttgccgggaatt
tcggagacggcgatgatattcgctggtgtcgatgtgactcgggaacccatccccgtttta
cccaccgttcattacaatatgggaggtgtaccgacaaactacaagggtcaggtgttaacc
agggaaaacaatgaggataaggtagtgcgcggattgtacgcatgtggtgaggcagcttgt
gcatctgttcacggcgccaatcgactaggtgctaattctctgttagatttagtcgtattc
ggacgtgcttgcgctaaaactatcgcccaggaaaataaacctggcgaaacgattggatct
ctcaaacctaacgcgggtgaagagacggtagccaacttagattgggtcagaaacgccaac
ggctctatatctactgcagaattgcgattgactatgcagaaaacgatgcagacgcacgca
gcggtatttagagaggcccagaccttgcaggaaggctatcgaaaaatgatagacctctat
aaaaaactcgacgaagtgaaggtcgcagacaggtctctaatatggaattctgatctgata
gagacgttagagttgcaaaatctcatggtcaatgctatgcagaccattgtaggggcagag
aacagaaaggagagtcgcggtgcgcatgctcgcgaagattacaaggatagaatcgacgaa
tatgattacagtaaaccgctcgagaaccaacaaccgaggccgtttgaacagcattggagg
aagcacacgttatcgaagatcaatccgaaaacgggagaggtgtctctggactacagaccg
gtaattgacgttacgctcgatcaacaggaatgtgcgacggttccaccagcgattcgttcc
tattaa

DBGET integrated database retrieval system