KEGG   Camponotus floridanus (Florida carpenter ant): 105254727Help
Entry
105254727         CDS       T03919                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00052  Galactose metabolism
cfo00500  Starch and sucrose metabolism
cfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105254727
   00500 Starch and sucrose metabolism
    105254727
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105254727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 105254727
NCBI-ProteinID: XP_011261897
UniProt: E2APT6
LinkDB All DBs
Position
Unknown
AA seq 570 aa AA seqDB search
MLRSCIFIAALIALTGSVPIQKAGKDWYKNSLVYQIYPRSYKDSNGDGIGDLNGITSKLE
HIADIGADALWLSPIYTSPQVDFGYDVANFTDINEEYGTLADFDRLVAKAKSLGLKVLLD
FELNYSSDKHEWFKKSIQRIKPYDEYYVWRDAKIVNGVRRPPNNWLSNFGGSAWEWNEVR
KQYFLHQFAVGQPDFNYHNADLRQEMKDVLTFWMKRGVEGFRCDALNYMYEDTRYLDEPL
SNAPGVPDNDYDYLDHIYTKNLPETYEVLKTWRQLMNDFSATADTKMILTEVYADLDLTI
KYYTSGSTVPFNFMFISDLNNKSSAPDFKRFIDRWINNIPDDPSYVANWVVGNHDNHRAA
SRYGEKRADQLSILSLILPGVSVIYNGDEIGMLDRNFTYEETKDFAGCNAGPDRYYLKSR
DPERTPFQWDNSTSAGFSTSNKTWLPVNSNYRTLNLAAQKTASISHYRVFVALAQLKKKP
IIERGSLETVLVTEKILGVIRRYESSVVAVLVNFADTPVTVDARTWMNIPDQMIIYVSSV
HSKLVPASLVDTTNITVPGSASIVLTTDLN
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgctcgtgcatcttcattgcagcgttaatcgctctgactggctcggtcccgatc
cagaaagcgggtaaagattggtataagaacagtctggtatatcagatttatccgagaagc
tataaggatagtaatggagatggcataggcgatttgaatgggatcaccagcaaattggaa
cacattgcggatattggcgctgatgcgttatggctatcaccgatctataccagtccgcag
gtagattttggctacgacgttgccaattttaccgatatcaacgaggaatatggtacctta
gccgactttgacagactcgtagcgaaagccaaatctctcgggttgaaagtactccttgat
ttcgaactgaattatagttcagacaagcatgaatggtttaagaagagcatccaacggatc
aagccttatgacgaatattatgtctggcgtgacgcaaaaatagtaaacggcgttagaaga
ccgccgaataattggttgagcaactttggaggctctgcttgggaatggaacgaggtacga
aaacaatatttcctgcatcagttcgctgtcggacaaccggatttcaactatcataatgcc
gatttgcgacaagaaatgaaggacgtgttgacattttggatgaaacgcggcgtagaaggt
tttcgctgtgatgcccttaattatatgtacgaggatactcgttatctggatgagccccta
tcaaacgcacctggagtaccagataatgactacgactatttggatcatatttatacaaaa
aatctccccgagacttatgaagtcctcaaaacctggagacagctgatgaacgatttctcc
gcgactgccgacacaaagatgatcttgactgaggtttacgcggatttggatttaaccata
aagtactatacatcgggctcgactgtgcccttcaacttcatgtttatttcggatctaaac
aacaagtccagcgcgcctgactttaagcgcttcatcgatcgttggataaacaatatacct
gacgatccgtcgtacgtcgcgaactgggtagtaggtaatcacgataatcatcgagcagct
tccagatatggcgagaaacgggctgatcaactttccatattatcgctcattttacccggc
gtaagcgtgatttacaacggtgacgaaattggcatgcttgacaggaattttacgtatgaa
gaaaccaaggatttcgccggatgtaatgctggacccgacagatattatctgaaatcgcga
gatccggaaagaacgcctttccagtgggacaacagcaccagcgccggtttttctacgagc
aataaaacgtggcttcccgtgaacagcaattacagaactctgaatttagcggcgcaaaaa
actgcgagcatatctcactacagagtattcgtggccctggcgcaattgaagaagaagccc
atcattgagcgaggctctctggagaccgtgttggtaaccgagaaaattctaggagtcata
cgacgatacgagtcatccgtcgtagcagtcctagttaactttgccgacacaccggtcacc
gtcgacgccaggacttggatgaatatcccggatcagatgatcatctatgtatccagcgtt
cattccaagctagttccagcctcactggttgacacgactaacataaccgtgcctggttcg
gcctccatcgtgcttaccacagatttgaattag

DBGET integrated database retrieval system