KEGG   Camponotus floridanus (Florida carpenter ant): 105256274Help
Entry
105256274         CDS       T03919                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00480  Glutathione metabolism
cfo00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105256274
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105256274
Enzymes [BR:cfo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     105256274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 105256274
NCBI-ProteinID: XP_025269933
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MTTRHLSTGSVLPPLVPGKIRLYSMRFCPYAQRIHLVLDAKQIPYDIVYVNLTHKPDWLI
EKSPLNKVPCIELEGGETLYESLIIADYLDDVYPQNKLYPSNPLAKAKDKLLIDRFNAVI
TTIYKVFYLGPTLEQDVFNEALNGLELFDQELAKRGSPFFGGSKPGMLDFMIWPWCERAD
VIRIIRGEQFVIPRERFLRLLEWRNAMKEDPAVRGSFLDVETHAKYIRSRIAGTPQYDLI
VNS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgactacaagacacttaagtaccggatcggtgcttccgccactcgtacctggaaaaata
cgtttgtatagtatgcgtttttgcccatacgcgcaaagaatacatctcgtgctggatgct
aaacaaattccatatgatattgtgtatgtgaatctaacacacaagccagactggttaata
gaaaaaagtccattgaataaagtcccttgcattgaattagaaggaggagaaacattatat
gagagcctaattattgccgattacctggatgatgtatatcctcaaaataaattatatcca
agtaatcctttagcaaaagctaaagataaattattaattgatagatttaatgcagtaata
acaactatatataaggtattttatttaggtccaacactagagcaagatgtatttaatgaa
gcattaaatggtttagaactttttgatcaggaattggcaaaaagaggaagtccctttttt
ggaggaagcaagcctggtatgttagactttatgatatggccatggtgtgaaagagcagat
gtgataagaattatacggggagagcagtttgtcataccaagagaacgtttcctgagactg
cttgaatggaggaatgcaatgaaagaagaccctgcagtacgtggcagctttctggatgtt
gaaacacacgccaagtacatacgtagtcgtatagctgggacacctcagtatgacttaata
gttaatagctaa

DBGET integrated database retrieval system