KEGG   Camponotus floridanus (Florida carpenter ant): 105257354Help
Entry
105257354         CDS       T03919                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1 isoform X2
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfo04040]
    105257354
Ion channels [BR:cfo04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   105257354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2 TFIIA Sensor TMEM51 DUF2722
Motif
Other DBs
NCBI-GeneID: 105257354
NCBI-ProteinID: XP_011266216
LinkDB All DBs
Position
Unknown
AA seq 848 aa AA seqDB search
MLHAVMLGSGPGRGRREWYPGFYLQRRRIGCRMNRGEQETLFRQSRQITRIVPSREDLVL
SVLKSPINQQQQQQQQHQQQQQQHQQQQQQQQPQQQQQRQQYRHPYQSQSQSHFNCPSHP
NNKKCNPSGDAYNNESLPRSKDQCSRHVEKRCSVTTAYAALQGSEDELVAEQGLDTEDTA
LKTPGSETEDTEDNGANAEDAPSPARRFTFLRRFRSPRFGEAHHKRVPTPMKRKYRRKKS
KEDIIENDVAGAEEEEPPSPDQTGMPDPYYPIYLPIDQAFKAKYVFHHKRGKTFQERLYV
FLEHPGGWLCFIYHFAVFMVVLVCLIFSVLSTIDQYSNFANETLFWMEICLVVFFGVEYM
VRLWSAGCRSKYMGCCGRLRFIRKPICIIDLIVVVASMVVLSVGSNGQVFATSAIRGIRF
LQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVGPDG
KTDFSSYADALWWGVITVTTIGYGDTVPQTWMGKIVASCFSVFAISFFALPAGILGSGFA
LKVQQKQRQKHFNRQIPAAAMLIQCLWRCYAADKAINSVATWNIYIKDPAPTGQPSTPLG
KLICVKKMVAKKASVLKRRKSRNRMDGQQQQQQSAVPPVTISGGISAGAGTGQNDNQRLE
NEGDVVFYMEEPKAGTPNRARRDNRVFPIGRGSLFTSQTSSVTEATSDEIDIDIEEPQRV
TTLTEAHRNAIRAIRKIKYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRL
DQTLGKPGSYLAGIDRAGNVKPMTIGARLYRVEQQLSVMDKKLDQLMYVLNAVAQKQQIP
LRSIEDDV
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacgctgttatgctaggtagcggtccaggacgggggagacgcgagtggtatcca
ggattttaccttcaacgtcgtcgtattggctgcagaatgaaccgtggcgagcaggaaacg
ctcttccggcagagtcgacagatcacgcggattgtaccctcccgcgaggatcttgtcttg
agcgttctcaagtcgccgattaatcaacagcagcagcagcagcagcaacatcaacagcag
cagcagcaacatcaacaacagcaacaacaacaacaaccacaacagcagcaacaacggcag
cagtatcgacatccgtatcaatcacaaagccagagtcactttaattgcccaagtcatcca
aataataagaagtgcaatccttcaggtgacgcgtacaacaacgagagtcttccacgaagc
aaggaccaatgctctaggcacgtggaaaagcggtgcagcgtcacgaccgcctacgctgcc
ctccaaggcagcgaggacgagctcgtggccgagcagggcctcgatacggaggacactgcg
ttgaagacgcctggcagtgagaccgaagacaccgaggataacggcgcgaacgcggaggac
gcgccgtcgccggcgcgccgtttcaccttcctacgtcgcttccgttcgccacgctttggc
gaagcgcaccacaagcgggtgccgacgcccatgaagcggaagtatcggcgaaaaaagagc
aaggaggacatcatcgagaatgacgtggccggcgccgaggaggaggaaccgccgagtccc
gatcagaccggcatgcctgatccgtattatccgatctacctgccgatcgatcaggccttc
aaggccaagtacgtgttccatcataagaggggcaagacttttcaggagcggctttacgtg
tttctcgagcatcccggcggctggctgtgtttcatctaccatttcgctgtgttcatggtg
gtattggtgtgcctcatatttagcgttttgtcaacgatagaccaatacagtaatttcgca
aacgaaactctgttttggatggaaatatgtctcgtggtattcttcggagtcgagtacatg
gttcgattatggagcgcgggttgcagatcgaagtacatgggttgctgcgggcggctacga
ttcatacggaaaccgatttgtatcatagatttaatcgttgtggtagcgtccatggtggtt
ctatcagtgggaagcaacggtcaagtatttgccacttccgccatcaggggtattcgattt
ttgcaaattcttcgaatgcttcatgtcgatcgtcagggcggcacgtggcggcttttaggt
tccgtggttttcatacatcgtcaggaattaatcacaacgctatacattgggttcttgggc
ctcattttcagcagctacttcgtgtatcttgccgaaaaagatgcagtcggacctgacggc
aaaacagacttctccagttacgccgatgcgctttggtggggagtgatcacagtaacgaca
ataggttacggtgatacggttccgcaaacatggatgggaaaaattgtggcttcatgtttc
agcgtgtttgctatatcctttttcgcacttccagctggtatcctaggttccggcttcgca
ttaaaggtacagcaaaagcaacggcagaagcattttaatcgacaaataccagctgccgcg
atgttgatacaatgcctgtggaggtgttacgctgccgacaaggccatcaacagcgtcgcc
acgtggaacatctacatcaaggacccggcgccaaccggacagccttcgacaccccttggc
aagttgatttgtgtaaagaagatggtggcaaagaaggcgagcgtgctgaagaggcggaag
tcgcggaatcggatggatggccagcagcagcaacagcaatcggccgtgccgcctgtcacg
atatccggcggcatatcagctggcgccggaactggccagaacgacaatcaacgcctcgag
aacgagggggacgtggttttttacatggaggagcctaaagcgggcacgccgaatcgcgcc
agacgcgacaatcgcgtgtttccgattggcaggggaagcctcttcacttcgcagacgagc
tcggtgacggaggcaactagcgatgaaattgacatcgacatcgaggaaccgcaaagagtc
accacgctgacagaagcacaccgaaatgctatccgggcaatcaggaagatcaagtacttc
gtggctcgcagaaagtttcaacaggctcgaaaaccatacgatgtgcgtgatgtcattgaa
caatatagccaaggtcatttgaacatgatggtgcggattaaggagttacagaggagattg
gatcagaccctgggtaaaccggggagctacctggcgggaatcgaccgggcaggcaatgta
aaacccatgacgattggtgcgcgcttatacagagtggagcagcaactatcggtgatggac
aagaagttggaccagttgatgtatgtactaaacgcggtagctcagaaacaacagatacct
ctgcgtagtatagaggacgatgtgtaa

DBGET integrated database retrieval system