KEGG   Camponotus floridanus (Florida carpenter ant): 105258144Help
Entry
105258144         CDS       T03919                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105258144
Peptidases [BR:cfo01002]
 Metallo Peptidases
  Family M2
   105258144
Exosome [BR:cfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105258144
CD molecules [BR:cfo04090]
 Proteins
  105258144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 105258144
NCBI-ProteinID: XP_011267538
LinkDB All DBs
Position
Unknown
AA seq 640 aa AA seqDB search
MLRLILVAAIVSLAASKPEGPVDPVEDSQAAAELLENAQAVLNRIDAEYAKWSNKRTLAE
WNYASNLTDENLAEKINVSTAAARVMKQIAEEVNAFPWKNLEDENLKRQFSKLGILGVAA
LPENSYKEFESTISQMENIYSTAKICDYKNRSRCDLALEPEITEILMHSRDPEELKHIWV
EWRKASGEQVKSLYPKYVELANTAARLNNFSDYAAYWMKDYEADDFPEQIETLWQQLKPL
YLQLHAYVRHELRKKYGESIVSKDGPIPAHLLGNAWAQTWSNIAEFTVPFPGKQLPDVSD
ALVEQGYNATSIFRLAENFFKSINLSAMPDTFWEKSILLKQKDTNMICHASAWDFYDGKD
FRIKQCTRINMEDLLTAHHEMGHVEYYLQYKHQPTVFKEGANPGFHEAVGDVISLSASIP
SHLKKIGLLKDDSTDREALLNHLYVKSLEKIVFLPFAYMMDRWRWDVFQGKVTPDNYNCN
WWSLAEEYQGIEPPVDRSEEDFDPGSKYHIIADVEYIRYYVSFVIQFQFHKALCTKAKQY
DPKNPSANPLHQCDIYDNKDAGNLLKSMLELGSSKPWPDAMEKIAGQRQMDSAGLLEYFK
PLTDWLTEENKRTNEYIGWKSSNRKCVQTREELRNNDPSE
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctaatcttggtagcggcaatcgtaagtttagcggcgtctaagccagagggt
ccggtagatcccgtcgaagattcgcaggctgctgcggaactattggagaatgctcaggct
gtcctgaaccgtattgacgcggaatatgcaaaatggagcaacaaaaggacccttgctgaa
tggaattatgcgtcaaacctcacggatgagaacctggcggagaagataaacgtatccacg
gcagctgcgcgtgtcatgaagcagatcgctgaagaagtgaatgcttttccttggaagaat
ttagaagacgagaatctcaaaaggcagttcagcaaactcggtatactcggcgtcgccgcg
cttcctgaaaatagttacaaggaattcgaatcgaccatcagtcagatggagaatatttac
agtactgcgaagatctgcgactacaagaataggagcaggtgcgatctcgcgcttgagccg
gaaatcactgaaatcttgatgcacagccgcgatcccgaggagttgaaacacatctgggtg
gagtggaggaaagcttcgggtgagcaggtaaaatctctgtatcccaaatacgtcgagttg
gccaacaccgcagcaaggctcaacaacttttccgactacgcggcctactggatgaaggat
tacgaggccgatgacttccccgaacaaatcgagactctttggcaacaattaaaaccgttg
tatctgcaactgcacgcttatgtccggcacgaactcagaaagaaatatggggagagcatt
gtttccaaggatggcccgattccagcacatttattgggcaacgcgtgggctcagacctgg
tcgaatatcgcggaattcaccgtaccatttcctggcaaacagttgccggatgttagcgac
gctttagtcgagcaaggttacaatgcgacaagcatattccgacttgctgagaactttttc
aaatcgatcaatctatccgctatgccagacacattctgggaaaagtcaatcctgttgaag
cagaaggacacgaacatgatctgccacgcgagtgcgtgggacttttatgatggcaaagat
ttcaggatcaagcaatgcacgcgcattaacatggaggacttattaacggcgcatcatgaa
atgggtcacgtcgagtattatttgcaatacaagcatcagcccactgtcttcaaggagggc
gcaaatccaggctttcacgaggcggtcggcgacgtcatctctctcagtgcgtccatcccc
agtcatctcaagaaaatcggactcttgaaggacgactcaactgaccgagaagcattgctg
aatcatctctacgtgaagagtcttgaaaagattgtattcttgccgttcgcctacatgatg
gatcgatggcgttgggatgtattccaaggaaaagtgacgcccgacaattacaactgcaat
tggtggtcgcttgcagaggagtatcaaggcattgaaccaccagtggatagatcagaagag
gacttcgatcccggttcaaaatatcacataatcgcagacgttgagtatataagatactat
gtaagtttcgtgatacaattccaattccataaagccctgtgcaccaaggcgaagcaatat
gatccgaaaaatccgagtgccaatccattgcatcaatgtgatatttacgataacaaggat
gccggaaacctgctaaaatctatgctggagttgggttcttcaaaaccatggccagatgca
atggaaaagatcgcaggtcaaagacaaatggattctgctggacttttggaatatttcaaa
cctttgaccgattggctgactgaagaaaataagagaactaatgaatatattggatggaaa
tcaagtaatagaaaatgcgtacagacgagagaagagcttagaaacaacgatccttctgag
taa

DBGET integrated database retrieval system