KEGG   Camponotus floridanus (Florida carpenter ant): 105258159
Entry
105258159         CDS       T03919                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo00230  Purine metabolism
cfo01100  Metabolic pathways
cfo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105258159
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105258159
Enzymes [BR:cfo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105258159
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258 DUF1053
Other DBs
NCBI-GeneID: 105258159
NCBI-ProteinID: XP_011267559
LinkDB
Position
Unknown
AA seq 1029 aa
MCCGCAAHALTEDDDEDCNIDAMSRRQETNEESYLNCGRPSNLLKTSFSSARLEKLYRAS
SLQQRRGGLTCFLMSAILYGVYAVSVPGIELLARTVTAVFLSLMVGLLIWAERGTKARNS
LWSVVPCIVGQMWIVHLPAQLFLKTTKVTPRDSLGWMLLLLYLLFASLPLKLCRCTLLAL
SSVLIYFFAVIGLSSATLEDLKTQPIDVLILTVTLFAGAAILGACSYCLAEFQQRRAFLE
TRQSLEVQLMIEEQSAEQERLLLSVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSIL
YADIVGFTAISSTYSASELVKILNELFARFDQLSERYEQMRIKILGDCYYCISGAPVEKP
DHAVLCVYMGLSMVEAIKYVQQITNSSVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVEL
ANKMESSGRAGRVHISNATLSFLNGEFEVEPAHGEDREEALQKAGLVTYFIVRALKPFKP
AVTKSLASLADAENSQRIMENAQDKGDNSKEDSEEFQQRLRKKLDSRGGATDLKGHVSWF
TLRFKDPGVETAFHETLEAFSPLSLLGGPLVTMCAAPAWRLQPWGPFTWGGAGVVALFGI
VLAGATCLASAVRATWFRSTLALLMTFSLIIFLLLDMTNCAIIDDIEPPKNTSLIVVTNW
RASRCPYPSYYSYIGVLALIAISMPTYLCYLTKACLMYFLAGTQSCINILFLASSLDRED
MASNTYGRSMPFPLKYSLAATLFVVATALIIVARYAEKARRMLYLRGREVMAQRERAADM
KRRNGALIYNILPPHVAAYFLSHARHYDDLYSQSYAEVGVLFASMPNFADFYSEESINNQ
GLECLRFLNEVISDFDAILDQKKFKNIIKIKTIGSTYMAASGITESTQSENGPRWGHLVT
LVEFALELKKALSSINEQSFNHFVLKMGINHGPVTAGVIGARKPHYDIWGNTVNVASRME
STGKVGCIQVTDETRRILEPFGFGFEQRGLVFVKGKGQLLTHYLISKDGVFLDLDSDLPV
EPTHPIIYQ
NT seq 3090 nt   +upstreamnt  +downstreamnt
atgtgctgtggttgcgcggcacacgctttaacggaagacgacgacgaggactgtaacatc
gacgccatgtcgcggcgacaggaaacgaacgaggaatcttacttgaactgcggcagacca
tcgaatctgctcaagacaagcttcagtagcgcccgactcgagaagctgtaccgcgcttcg
tccctgcagcagcgtcgcggcggcctcacgtgtttcctgatgtcggcgattttatacggc
gtctacgcggtatcggtgccgggtatcgagctgctggcacgcaccgtcaccgccgtgttc
ctcagccttatggtcggtctgctgatatgggccgagcgcggcaccaaagcgaggaactcg
ctctggtcggtggtaccgtgtatagtcggacagatgtggatcgtccacctgcccgcacag
ctgttcctcaagaccaccaaggtcacgccgagggacagcctaggatggatgttgctgttg
ctatacttactgttcgccagcctgcctctcaagctctgccgttgcacgttgctcgcgctc
agcagcgttctcatctacttcttcgccgtgatcggtctctctagcgcgacattggaggac
ctcaagacacagcccatcgacgttctgatcctgacggtgacactctttgccggcgccgct
attttgggcgcttgcagctactgtctggcggagttccagcaacgccgggcattcctggag
accagacagagtctggaggtccagcttatgatcgaggagcagagcgcggagcaggaacgg
ctgctgctaagcgttcttcccgagcatgtcgcggtcaagatgcggcaggacctcggcgcg
tccctcgacacgcaattcaagaagatctacatgtctaggcacgagaacgtgtcgatactt
tacgccgacatagtcggcttcaccgcgatctcgtcgacctacagcgccagcgagctcgtc
aagatactcaacgagctgttcgcgcgattcgatcagctcagtgaacgatacgagcaaatg
cgtatcaagatcctgggggactgttactactgtataagtggtgcgcccgtcgaaaagccg
gaccacgcggtcctttgcgtatacatgggtctatccatggtggaggccatcaagtatgtt
caacagataacgaacagttctgtcgatatgagggtgggcattcatacgggcgcggtgctc
gccggggttcttggtcagagacagtggcagtttgacgtttacagcaaggacgtcgagctg
gcgaacaagatggagagcagcggaagggctgggagggtgcatatctcgaacgcgacgttg
agcttcctaaacggagaattcgaggtcgagccggcgcacggggaggatcgggaagaggca
ctccaaaaggccggccttgtcacttactttatagtgagagccttgaagccatttaaacca
gcggtaacgaagagcctcgcgtcgttggcggacgcggagaattcgcaaaggataatggag
aacgcgcaagacaaaggggacaatagtaaagaggattccgaggaatttcagcaacgtcta
agaaaaaagctcgacagtagaggtggtgctaccgacctgaaaggtcacgtctcctggttc
accctacggttcaaggatccgggagtggagacggcgtttcacgaaacgttggaggccttc
tcgccgctgtcgctcctcggcgggcctctggtgacgatgtgcgcagccccggcctggagg
ctgcagccctggggaccgttcacctggggtggtgctggcgtagtcgcccttttcggcatc
gtgctcgctggggccacttgtctggccagcgccgtcagggcgacgtggttcaggagcact
ctcgccctcctaatgactttctcccttataatatttctgttattggacatgaccaactgt
gcgatcatcgacgacatcgagcctccaaagaatacctcgctaattgtggtcacaaactgg
cgggcctcgcgatgtccgtatccctcgtattattcgtacatcggcgtcctcgcgctcatc
gctatctcgatgccgacgtacctctgttacctgaccaaggcgtgcctgatgtatttcctt
gctggcacgcagtcctgcatcaacattttgttccttgcatcgagcctcgacagggaggac
atggcatcgaatacttatgggcgatcgatgcccttcccgctgaaatattcgttggcagcc
accttgttcgtcgtcgcgaccgcgctaatcatcgtggcgagatacgctgagaaggcacga
agaatgttatatttgcgaggacgagaagtaatggcgcagagagaacgggcagctgacatg
aagcggagaaatggcgcgctgatatataacatcctgccgcctcatgtggccgcctatttc
ctgtcgcacgcgagacactacgacgatctctacagtcagagctacgccgaggtgggcgtg
ttgttcgccagcatgccgaatttcgcggacttctacagcgaagagagcatcaacaatcaa
ggcctcgagtgcctcaggttcctgaatgaggtcatctctgatttcgacgccattcttgat
cagaaaaaattcaaaaacatcatcaaaatcaagacgataggctcaacctacatggctgcc
tcggggataacggaatcgacgcaatcggagaacggtccccggtggggtcatcttgtcacc
ctcgtggagtttgctctagagcttaaaaaggctctgtcaagtatcaacgagcagagcttc
aatcatttcgttctaaaaatgggcatcaatcatgggccggtaaccgccggtgtcatcgga
gcgcgaaagcctcactacgacatttggggcaacactgtcaatgtcgcgtcgaggatggag
agcacaggaaaagtcggctgtattcaggttactgatgagacgcgaaggatactagaacca
tttggttttggattcgaacaacgtggtcttgtattcgtcaagggcaagggacagcttttg
acgcactatctcatctccaaggatggcgtttttctggacctggacagcgatttgccagtt
gaacccactcatccgataatctatcaataa

DBGET integrated database retrieval system