KEGG   Camponotus floridanus (Florida carpenter ant): 105258184Help
Entry
105258184         CDS       T03919                                 

Definition
(RefSeq) neurogenic locus Notch protein isoform X1
  KO
K02599  Notch 1
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo04320  Dorso-ventral axis formation
cfo04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    105258184
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    105258184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Notch Ank NODP Ank_5 Ank_4 NOD Ank_3 DUF3454 EGF_2 EGF_3 cEGF DUF5316 DUF3098
Motif
Other DBs
NCBI-GeneID: 105258184
NCBI-ProteinID: XP_025268966
LinkDB All DBs
Position
Unknown
AA seq 2501 aa AA seqDB search
MSRRRLDYAFRIEPLLLALLATICLPTVSGFVSCSPSPCKNGGLCVSSPRGESHCNCTSK
HVGEYCQHLNPCHTGSRCQNGGSCRVRESIGGGTPSFACSCPVGFTASLCEIPIENACDS
SPCLNGATCNLKSLYEYVCTCSIGYTGEHCERQDYCASSPCRNGAECRSLEGSYKCTCAP
GFTGPNCTDDINECDRNPCRHGTCKNIHGSYKCMCSSGYTGQNCESDYIPCDPSPCENGG
SCQQVSELGYACHCPEGFQGTNCEENIDDCPGNLCQNGATCMDRVNEYSCLCPPAFTGTQ
CELDVDECSVRPSLCHNGATCTNSHGSYSCICVNGWAGLDCSVNIDDCAGAACFNGATCI
DRVGSFFCQCTYGKTGLLCHLDDACTSNPCHEGAICDTSPINGSFTCSCATGYKGLDCSE
DIDECEQGSPCEHDGICVNTPGSFACNCTQGFTGPRCETNVNECESHPCQNDGSCLDDPG
TFRCVCMPGFTGTQCEIDIDECAARPCLNNGICSDLINSFKCSCADGFAGSHCQINIDDC
ASSPCKNGGTCQDGIARYTCECPPGFTGASCETNINDCASNPCHSGTCIDGENSFVCNCY
PGFTGKLCQTQIDECESNPCQFGGKCEDRINGYQCICRPGTSGINCEVNVNECYSNPCRN
GARCIDGINRYSCECEPGYTGQHCETDINECASNPCANGGLCIDLTNSFRCECPRGYYDA
RCLSDVDECSSSPCLNGGTCEDGVNQFICHCLPGYGGKRCEMDIDECGSNPCQHGGTCND
HLNGYSCKCLPGYAGTNCETNIDDCANNPCQNGGSCIDLVDDYKCVCELPHTGRNCEEKL
DPCSPNKCLHGAKCSPSSNFLDFACTCTVGYTGRLCDEDVDECVMTSPCRNGATCRNTNG
SYHCVCAKGYEGRDCIINTDDCASFPCQNGGTCLDGIGDYTCLCVDGFSGKHCEVDIDEC
ISQPCQNGAICKEYVNSYTCQCRRGFSGINCQTNDQDCTDSSCMNGGKCIDGINNYTCVC
KHGYTGSNCQYRINECDSSPCKNGATCHDHVQYYTCHCPYGYTGAHCDAYVNWCADNPCE
NQATCAQVKNKYQCNCSPGWTGKVCDVEMVSCKDAAIRKGVLEKNLCNNGTCEDIGNSHR
CHCLEGYTGSYCQKEIDECESAPCQNGATCKDLIGSYQCLCTKGFQGQNCELNVDDCQPN
PCQNGGICHDQINGFNCSCPFGTLGIICDVNTDDCLIGACHNNGTCTDKVGGFECKCPPG
FVGPRCEGDINECLSNPCASPGTQDCVQLVNNYHCNCKPGYMGRHCEIKVNFCDSSPCQN
GGVCTAKQDRHTCVCPSGYHGTNCEFVGSYCDAEPCQNGGTCHVSGTSYRCYCTSGTTGT
HCEFDARDECKSNPCQQDAPCVNKIDDYACDCPPKWVGKNCEIYDPNYPGGVFGVQPNVP
KISNAYDYNTERERRKCIENNCEEKAGNNRCDEECNKHACNFDGQDCSLGINPWRNCSAP
IKCWDVFMNGMCDEVCNNPQCLFDGRDCERKVGPCNPVYDAYCKQHYANGHCDYGCNNEE
CNWDGLDCDGEPPSLAKGAISIVVRMDMESFREHIVTFLRELGNELRTTTRVKQDELGND
MIYPWKPERDPDYNFGRPTIIHPNNQNGVIIYLEIDNRKCIPSSMMSGLTTSRRDATGCF
PSANEAAEYLAATASKHTLLRNFPIEQVRGVVDPQGPEYPDSTTNYKYVFIGVVIVVLGG
LLMGVLVTAQRKRAVGVTWFPEGFLRTSSGSGQRRRSRRRGPDGQEMRNLNKQPSVNCMD
LDVVTRVQSQWSDDESDLPPSKRMRAIEPGYASDHTAITDYEETEPRMWTQQHLDAAEIC
RPDAGGVLTPPSLEHGQDVNARGPCGMTPLMVAAVRGGGLDTGEEEDENDGAAAKIADLV
AQGADLNAKTTDKSGETSLHLAARYARSDATKRLLDAGADANSQDNTGRTPLHSAVAADA
MGVFQILLRNRATNLNARMHDGTTPLILAARLATEGMVEDLINADADINAADNSGKTALH
WAAAVNNVDAVNILLVHGANRDAQDDKDETPLFLAAREGSFEACKALLDTFANREITDHM
DRLPRDVASERLHHDIVRLLDEHVPRSPQMVTVIPNGPLMGSPNHPQLITHPTVIGSAPK
QTKSKKRPKAGNPNSPESEGVVVMVRRKPSVKKPPAKRGAQPPNQEIPQGAEGADGNLPT
SPYDSASLYSNALPLVAHTATAKQPPPYEDCIKGQSMQGLQQLGLDTFATNYGLPFHDQL
LAPHQRQQQGMVNTLSPPYSNQSPPHSVQSNMTLSPQASYMGSPSPAKSRPSLPTSPTHI
AAMRQATHQKHGSMPPVGFDFDNLPYTSSQAQQQQQQQQQQQQQQMQQTQQQIQQQPQQQ
QPQQQQQSTQQQQQQYYQYLTPPSHHSGPDVTPQHLMQAPESFPTPSPDSPGHWSSSSPH
SNSDWSECLAASPPQAPPTNVYGAGSGAHQSNKSTEAAIYI
NT seq 7506 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggcggagattggattacgcgttccggatcgagccgttgctgctcgcgctcctg
gcgaccatctgcctgcccacggtatccggtttcgtgtcgtgttcgccgagcccgtgcaaa
aatggaggactctgcgtgtcatcgccgcgcggcgagtcgcattgcaattgcacatcgaaa
cacgtgggagaatattgtcaacacttgaatccgtgccacacgggatcgcgctgccaaaac
ggcggttcgtgcagggtgcgcgagagcatcgggggtggcacaccatccttcgcgtgttcc
tgtcccgtgggctttaccgccagcctttgcgaaattcctatcgaaaatgcctgcgactcc
tcgccctgcctcaacggcgccacatgcaatctcaaatcgttgtatgaatacgtgtgcacg
tgcagcatcggatatacaggcgagcactgcgaacgacaggattactgtgcctcgtcgccc
tgtcgaaacggggccgagtgtcgctcactcgagggcagttacaagtgcacgtgtgcacct
ggcttcacgggaccgaattgcacggacgacatcaacgagtgtgacaggaacccgtgcaga
cacggtacctgcaagaatattcacggatcttacaaatgcatgtgctcgagcgggtacacc
ggacaaaattgcgagagcgactacatcccctgcgatccttcgccatgtgaaaacgggggc
tcgtgtcaacaggtcagcgaactcggctacgcgtgccactgtcccgaaggcttccagggc
accaactgcgaggagaatatcgacgattgtccgggtaatctctgtcaaaatggcgccacg
tgtatggaccgggtaaacgagtactcctgcctgtgtccgccggccttcaccgggacgcaa
tgcgagctggacgtggacgagtgctccgtaaggccatccttgtgtcacaacggggccacg
tgtacgaattcgcacggcagttactcgtgtatatgcgtgaacggctgggccgggcttgac
tgtagcgtcaacatcgacgattgtgcaggtgcggcctgtttcaacggtgccacctgcatc
gatcgcgttggcagcttcttttgccagtgcacatacgggaagacaggcctgctctgccat
ctcgatgacgcttgcacgtcaaatccgtgtcacgagggcgcgatctgcgacaccagccct
atcaacggatccttcacctgttcctgcgccaccggctataaaggactggattgctccgag
gatattgatgagtgcgaacaaggctctccctgcgagcacgacgggatctgcgtgaacacc
cccgggtccttcgcgtgcaattgcacgcaaggattcaccgggccgcgatgcgagacgaac
gtgaacgagtgcgagtcgcatccctgccagaacgacggttcctgcctggacgatcctggg
accttccgatgcgtctgcatgcctggcttcaccggcacccaatgcgagatcgatatagac
gaatgcgcggcgaggccgtgcctgaacaacggcatctgcagcgatctcatcaactccttc
aagtgcagctgcgccgacggcttcgccggctcccactgccagatcaacatcgacgactgc
gcctcgtcgccgtgcaagaacggcggtacctgccaggacggtatagccaggtatacgtgc
gagtgtccgcccgggttcaccggcgcctcctgcgagaccaatatcaacgactgcgcgtcg
aatccgtgtcacagcggtacctgcatcgacggcgagaacagcttcgtctgcaactgctac
ccgggtttcaccggcaaactgtgtcagacgcagatcgacgagtgcgagagcaatccttgc
cagttcggcggtaaatgcgaggaccgcatcaacggctaccagtgcatctgccgaccggga
acgtccggcatcaattgcgaggtcaacgtcaacgagtgctatagcaatccgtgccgaaac
ggggccagatgcatcgacggtatcaacagatactcctgcgaatgcgagcccggctacacc
ggccagcactgcgagaccgacataaacgagtgcgcgagcaacccatgcgcgaacggcggc
ctctgcatcgacttgacaaacagcttcagatgcgaatgtccgcgcggctactacgacgcc
aggtgtctgagcgacgtggacgagtgctcgagctcgccctgcttgaacggcggcacttgc
gaggacggggtgaaccagtttatctgccactgtctacccggttacggtggcaagaggtgc
gagatggatatcgacgagtgcggctcgaatccctgccaacacggtggcacgtgcaacgac
catctcaatggctacagctgcaagtgcctacctggttacgccgggaccaattgcgagacg
aacatcgacgactgcgccaacaacccctgtcaaaacggtggatcctgcatcgatctcgtc
gacgattacaaatgcgtctgcgaactgcctcacaccggcaggaattgcgaggagaagctg
gacccttgctcgcccaacaaatgtctccacggagcgaaatgctcgccatcatcgaacttc
ctcgacttcgcttgtacgtgcacggttggttatacgggcagactgtgcgacgaggatgtg
gacgaatgcgtgatgacgtcgccgtgcagaaacggtgccacttgtcggaacaccaacggc
tcttaccattgcgtgtgcgcgaagggctacgagggccgtgattgcatcatcaataccgat
gactgtgcatcatttccctgtcagaacggcggtacctgtctggatggcatcggcgattac
acgtgtctctgcgtggatggtttcagcggcaagcactgcgaggtcgacatcgatgagtgt
atatcgcagccctgtcagaatggagcgatttgcaaggaatacgtcaactcctacacgtgt
caatgccgacgcggtttctctggaatcaattgtcaaaccaacgatcaagactgcaccgat
agtagctgcatgaacggcggcaaatgcatcgacggtatcaacaattatacgtgtgtttgc
aaacatggttatactggatccaactgtcagtatcgtatcaacgagtgcgacagctcaccc
tgcaagaatggtgccacctgtcatgatcatgtgcagtattacacatgtcattgtccatat
ggttacacgggtgcacattgcgatgcgtatgtaaactggtgcgccgataatccgtgcgag
aaccaggctacgtgcgcgcaagtgaagaacaagtatcagtgcaattgctcgccgggatgg
accggcaaggtttgcgacgtggagatggtttcgtgcaaggatgccgcgatacgaaagggc
gtgctggagaagaatctctgcaacaacggcacctgcgaggatataggcaacagtcatcgt
tgtcattgtctcgaaggctacaccggttcgtactgtcagaaggagatcgatgaatgtgag
tcggcgccgtgtcaaaacggtgcaacatgcaaggacctcattggctcgtatcagtgtcta
tgtaccaagggcttccaaggtcagaactgcgagctcaatgtcgatgactgccaaccaaat
ccctgccagaacggtggcatctgtcacgatcagatcaacggattcaattgttcttgcccg
ttcggtactcttggtatcatatgcgacgtcaacaccgatgactgcttgataggtgcctgt
cataacaacggtacctgtaccgataaggtgggcggtttcgagtgcaaatgtccgcccggt
ttcgtcggaccgagatgtgaaggcgatatcaacgaatgcctgtcgaatccgtgcgcctcg
cctggcacacaggattgtgtacaactggtcaacaactatcactgtaattgtaagcctggt
tatatgggtcgtcactgtgagatcaaggtgaatttctgcgacagctcgccgtgtcaaaac
ggtggggtatgcacggctaagcaagacaggcacacgtgcgtgtgccccagcggttatcac
ggtaccaattgcgaatttgttggctcttactgcgatgccgagccgtgtcaaaacggtggc
acgtgtcacgtttctggaaccagctatcgatgctattgcacgtcaggtacgacggggacg
cactgcgagttcgacgcccgagacgaatgcaaaagtaacccgtgccaacaagatgcacct
tgcgtcaacaagatcgacgactacgcttgcgattgtcctcccaagtgggtcggcaagaac
tgtgagatatacgatccgaattatcctggcggtgtgttcggtgttcaacctaatgtcccg
aaaatctcgaatgcttatgattataatactgagcgcgagcgtagaaagtgtattgaaaac
aattgcgaggagaaagctggcaataatcgctgcgacgaggaatgcaacaaacatgcatgc
aactttgacggacaggattgctcacttggcatcaatccgtggcgtaattgttccgcgccc
attaaatgctgggacgtatttatgaacggtatgtgcgacgaggtctgcaacaacccgcag
tgccttttcgatggcagagactgcgagcgaaaagtcggcccttgcaatccggtttacgac
gcgtactgcaagcaacattacgcaaacggtcattgcgattatggctgcaacaatgaagag
tgtaattgggacggcctcgactgcgatggagaaccaccatcattggctaaaggtgccata
tctattgtcgtaagaatggacatggagtccttccgcgagcacatcgtgacttttctacgc
gaactcgggaacgaactgagaacgacgacacgcgtgaagcaggatgaactcggtaatgac
atgatatatccttggaaacccgagagagatcccgactataatttcggtcgcccaacgata
atccatcccaataatcaaaacggtgtgatcatctatctggagattgataaccgcaaatgc
atcccttcctcgatgatgtcggggttgactacttcccgtcgagatgccacaggatgcttt
ccatcggccaatgaggcggctgagtatttggccgccacggcgtcgaagcacaccctgttg
cggaacttccccatcgagcaggtgcgaggtgtggtagatccccagggtccagagtatccc
gacagtacaacaaattacaagtatgtctttatcggcgtggtcatcgtggtgctcggtggt
ctactgatgggcgtactggtgaccgcacaacggaaacgcgccgtaggagttacatggttc
cccgagggcttcttgaggaccagcagcggcagcggccaacggcgccgctcgcgccgacgc
ggtccagacggtcaggagatgcgcaatctgaacaaacaaccatcagtaaactgcatggac
ctggacgtagtgactcgggtgcagtcccagtggtccgacgatgagtccgatcttccgcct
tcgaaacggatgcgggcgatcgagccgggttacgcgagcgatcacaccgctatcacggat
tatgaagagaccgagccgcgcatgtggacgcagcagcatctggacgctgccgagatatgt
cggccggatgcgggcggtgtcctgacgccgcccagcctggaacacggccaggatgttaac
gcacgtggtccatgtggcatgacacctttgatggtagcggccgtgcggggcggtggcctc
gacactggcgaagaagaggacgagaatgatggcgccgcggccaagatcgctgatctggtc
gcccagggcgccgatttgaacgccaagaccacggataagagcggcgagacgtcgttgcat
ctagctgcgcgttacgctcggtctgacgcaaccaagagactgctagacgccggcgccgac
gcgaattcccaggataacaccggacgtacgccgctgcactcggcggtcgcagccgatgct
atgggcgtctttcaaattctgctgcgcaatcgggcgacgaatttgaacgctcgtatgcat
gatggtacgacgccgttgatactagccgcgcgtctagccaccgaaggtatggtcgaggat
ctcatcaacgccgacgccgacattaacgccgctgacaacagcggcaagaccgcgttgcat
tgggcggcggcggtcaataacgtcgacgccgtaaacatattattggtgcatggcgcgaac
agagatgctcaagatgacaaggatgaaaccccgttgttcctcgccgcacgcgagggcagc
ttcgaggcgtgcaaagcgttattggacacgttcgccaacagggaaattactgatcacatg
gatcggttaccgcgcgatgtcgccagcgaaagactacatcatgatatcgttagactactt
gatgaacatgtgccaaggtcaccgcagatggtcacagtcattccgaatggtcctctcatg
ggctctccgaatcatccacaattaatcacacatcccacagtaatcggctcggcgccgaag
cagaccaagtcgaagaagcggccaaaggcgggaaacccaaacagcccggaatcggagggc
gtagtagtgatggtgaggcgaaagccatcggtgaagaaaccgccggccaaacgcggcgct
caacccccaaaccaggagatcccacagggagcggaaggcgccgatggcaacttgccaacg
agcccgtacgacagcgcgagcctctacagcaacgcgttgcccctggtggcgcacacggca
acagcaaaacagccgcctccgtacgaggattgcatcaagggtcagtcgatgcaaggcctg
cagcaactcggtctggataccttcgcgaccaattacgggctgccgtttcacgaccagctc
ttagcgccgcatcagcggcaacagcagggtatggtgaacacactgtcgccaccgtacagc
aatcaatcgccgccacattcggtgcaatccaacatgactctctccccgcaagcgagctac
atgggctcgccatcgccggcgaaaagtcggccatcgttacccacctcgcctacccacatc
gccgccatgaggcaggcgacgcaccagaagcacggcagcatgccgccagtgggattcgac
ttcgacaatctgccatacacctcgagtcaggcgcaacagcagcagcaacagcagcagcag
cagcagcaacagcagatgcagcagacgcagcagcagatccagcagcaaccgcagcagcag
cagccgcagcagcagcagcaaagtacgcaacagcagcagcaacaatattaccagtacttg
acgccgccgtcccatcattccggacccgatgtcacgccgcagcatctcatgcaggcgccc
gagagctttccgacgccatcgccggacagtccgggccactggtcctcgagctcgccccat
tccaacagcgattggtccgagtgcctagcagcatcaccaccacaagcaccacccacgaac
gtctacggcgccggaagcggcgctcaccaaagcaacaagagtaccgaggcggcgatctac
atatga

DBGET integrated database retrieval system