KEGG   Camponotus floridanus (Florida carpenter ant): 105258549
Entry
105258549         CDS       T03919                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105258549
SSDB
Motif
Pfam: CDI MCM_bind
Other DBs
NCBI-GeneID: 105258549
NCBI-ProteinID: XP_011268168
LinkDB
Position
Unknown
AA seq 130 aa
MKNTPRKARLTMERNASENERNVRRQLFTDENESEDERQNYDNLIMEDNLQQSERDKEKW
NFDFKRGVPLPGRYQWIKLDEHGNEIPSSINSINEVQNTNEQEEQIEETERRRNDEPMDE
ARKRARLEES
NT seq 393 nt   +upstreamnt  +downstreamnt
atgaaaaacaccccgaggaaagcccggttgacgatggaaagaaatgcatcggaaaatgaa
agaaacgttcgtagacaactctttacagatgaaaatgagagcgaagatgagagacaaaat
tatgacaatctaattatggaagacaacttacaacaatcagaaagggataaggaaaagtgg
aactttgattttaagcgtggagtgccattacctggccgatatcaatggataaaattagac
gaacacgggaatgaaattccgagttccataaattcaattaatgaagtacaaaatacaaat
gagcaagaagaacaaatagaggaaacagaaagaagaagaaatgatgaaccaatggatgag
gcaagaaaaagagctagactagaagaatcgtaa

DBGET integrated database retrieval system