KEGG   Camponotus floridanus (Florida carpenter ant): 105258735Help
Entry
105258735         CDS       T03919                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfo01002]
    105258735
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfo04147]
    105258735
   04090 CD Molecules [BR:cfo04090]
    105258735
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105258735
Peptidases [BR:cfo01002]
 Metallo Peptidases
  Family M2
   105258735
Exosome [BR:cfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105258735
CD molecules [BR:cfo04090]
 Proteins
  105258735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 105258735
NCBI-ProteinID: XP_011268507
LinkDB All DBs
Position
Unknown
AA seq 689 aa AA seqDB search
MEFTFSETGKLLNCVSVSFIRWTAFVLCLLPAIFGQLDLPPYRDDNIGRQLPSNEVDYRN
ILARLDFLGAERCSANVIAQWAYETNANEYTQLQALDAQRLYADFQYQAWLLISRIDINS
IQDPIIRRRLRYLFVVGPSALPPDQLDRYNRLTNDMLAVYNGATICAYNDPFRCGLRLYP
DISQIMAKSRDWDELQYVWTEWRRRSGTPIKDLYQQLITLNNDAARLNNFTDASEYWMFP
YESLNFQQDIDQVWEMIRPLYEELHAYIRRKLRELYGPEKIGGHAPLPSHILGNIWAQSW
SNLLDVTLPYPGKTYPDVTPEMQAQGYTPIDMIRVAEEFYLSLNLSAMPPEFWAGSIIAD
PGDRPLICQASAWDFCNRLDYRIKMCTKVTMKDLITLHHEMAHIQYFLRYSGLPREFRDG
ANPGFHEAIGETVALSVATPRHLQTLGLANKFIDERSADINYLFSLAMEKLVMLPFSITM
DRWRWDVARGYVNREEYNCHWHRLMEQYAGTKPPVLRSEDDFDPGAKYHIPADIPYIRNF
VAGVLQFQLYRALCQAAGQRYPDNPRRPLHRCDFYRSPEAGGILGRLMEKGSSIPWQETL
REATGEARLDGSALREYFRPLEDWLRTENLRTGEIVGWSYDGDFCKRSIETAGLQVYGSG
FYNGGSASSYVSWIATGIIMTFWTVSMLY
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggagtttacttttagtgagacggggaagctgttaaactgcgttagcgtaagcttcata
agatggacagcgttcgtactttgtttgctgccggcaattttcggtcaattggacttgcca
ccatacagggacgacaatattggccgtcaacttccttccaatgaagtagattaccgaaat
atcttagctagattagatttcctcggtgcagagagatgcagtgccaacgtaatagctcag
tgggcgtacgaaaccaatgccaatgaatatacacagctgcaagcgctggatgcacaaagg
ttatatgcggatttccaatatcaagcttggcttttgatttccagaattgacataaattct
attcaggatcctataattagacgacggcttcgttatttattcgtcgtcggtccttcggca
ctaccacctgatcaattagacaggtacaatcgcttaaccaatgatatgcttgcggtttat
aatggagccaccatatgtgcttacaacgatcccttccgatgtggattacgtttatatcca
gatatatcgcaaattatggcaaaaagtcgagactgggatgaattgcaatacgtctggact
gaatggagaagacgaagtggtacaccgattaaagatctatatcaacaactgattacgctg
aacaatgatgctgcaagattgaacaattttacggatgcttctgaatactggatgttccct
tatgaatctctcaattttcaacaagatattgaccaggtttgggaaatgatacgtccactt
tacgaagaattgcatgcttatattcgcagaaagttaagggaactttacggtcctgaaaaa
atcggcggacatgcgcctcttccatcccatatccttggtaatatatgggcacaatcttgg
agcaatctcttagatgttaccttaccgtatcctggaaagacatatcctgatgtcacacca
gaaatgcaagctcaaggctatacaccaattgacatgattcgagtggccgaggaattttat
ctgtccttgaacttgagtgctatgccaccggaattttgggccggaagtataatcgccgac
ccgggcgaccgtccactaatctgtcaagcctctgcgtgggacttttgcaatcgtttagat
tacaggattaagatgtgtacaaaagtgacaatgaaggatctgataactctacatcatgag
atggcacacattcagtatttcttacggtatagcggtctacctcgcgaatttcgtgatggc
gctaatccaggatttcacgaagcaatcggcgagactgtcgctttgagtgtcgcgacgccg
cgtcatctgcaaactctgggtctagcgaacaaattcatcgatgaacgatccgcggatatc
aactacctcttttcgttggcaatggaaaaactcgtgatgctacctttcagcatcacgatg
gacagatggcgatgggacgttgctcgcggttacgtgaacagggaagaatacaattgtcac
tggcatagactgatggaacaatacgcggggacaaaaccgccggtactgagatccgaggac
gattttgatccaggtgcgaagtatcacattccggccgacatcccgtacataaggaatttc
gtggctggcgtccttcaattccaactgtatcgtgctctctgccaagctgcgggacagaga
taccctgacaatccaagaagaccgctgcacagatgcgatttttacagaagccccgaggcc
ggcggaatcttggggagattgatggaaaagggttcgtccattccatggcaggaaacgctc
cgggaagccactggtgaggccagattagacggatccgctcttagggaatacttccggccg
ttggaggattggctgaggaccgagaatttgaggacgggtgaaattgtcggctggtcatac
gatggagatttttgcaaaaggagcatagaaactgcagggctgcaggtctacggtagcggt
ttttacaatggcggttctgcatcgagctatgtgtcttggatcgcaacaggaatcataatg
acattttggacagtatcgatgctttattaa

DBGET integrated database retrieval system