KEGG   Camponotus floridanus (Florida carpenter ant): 105259166Help
Entry
105259166         CDS       T03919                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo03030  DNA replication
cfo03410  Base excision repair
cfo03420  Nucleotide excision repair
cfo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cfo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    105259166
   03410 Base excision repair
    105259166
   03420 Nucleotide excision repair
    105259166
   03430 Mismatch repair
    105259166
Enzymes [BR:cfo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105259166
    6.5.1.6  DNA ligase (ATP or NAD+)
     105259166
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105259166
DNA replication proteins [BR:cfo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105259166
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105259166
DNA repair and recombination proteins [BR:cfo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105259166
   NER (nucleotide excision repair)
    Other NER factors
     105259166
   MMR (mismatch exicision repair)
    Other MMR factors
     105259166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 105259166
NCBI-ProteinID: XP_011269232
LinkDB All DBs
Position
Unknown
AA seq 883 aa AA seqDB search
MAQRRIDSFFTRISSKKENSSEDYSESNLSDKEKNQDAPGSGKRKRDSNGFASPPSKKVD
KLTKPKSISKTPSPGAKSRAKLGTTPKNKTTKLSPGANKKRKLTNTPKKEKKDEAKNING
TEIVENIQENDTVKNEREKSIPRDTKYNSDEATKMKNKVKKKRARIIETDSSDDDHLPLP
ESPKKLETNSKEPTPEKKSKTTSKKVHSFFTSKEKDDAKDTSDVKNNNQSYNPSISGYHP
INNACWKRGDKTPYSAFTRTLELIEETSARLKIIEILSNYFRSVIVLSPMDLLPSVYLCL
NQLAPAYEGIELGVADTNLMKAIAQCTGRTLAQIKADVQEVGDLGIVAEGSRSNQRTMFQ
PAPLTVLVVYSKLKEVAQMTGHASLTKKLDKIQTLFVACRNTEARYLIRSLAGKLRIGLA
EQSVLQALALACAMTPPQQSYPPEILNANKNLSSDRFKQKYDEIALILKTTYCECPNYNL
IIPVLLEDGINGLPSKCKLTPGIPLKPMLAHPTKGIQEVLTRFEGLKFTCEWKYDGERAQ
IHVADNGHINIYSRNQENNTSKYPDIIKRFKNTRGDLVKNCILDCEAVAWDNEQKQILPF
QVLSTRKRKDANEKDIKVQVCVFMFDLLYLNDEPLVKESFAKRRELLKQHFKEIEGEWKF
ANSMDTTTMEEVQIFLDESVKGNCEGLMVKTLEEEATYEIAKRSRNWLKLKKDYLDGVGD
TLDVVVIGGYIGKGKRTGTYGGFLLACYDQENEEYQSICKIGTGFKEEDLENHTKFFKDH
VISQTKSYYRFDSSHEPDHWFEPVQVWEIKCADLSLSPVHRAAIGIVDPEKGISLRFPRF
IRIREDKNCEEATSAQQVADMYNNQEQIKNKTSASKATEEDFY
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacgtcgtatagactctttcttcacgaggatatcgtccaagaaggagaactcg
agcgaggattattcggagagcaatttgtccgacaaggaaaagaatcaggatgcaccggga
agcggcaaacggaagagagatagcaatggatttgctagccctccttccaagaaggtagac
aaacttacgaagccaaagtcaatttccaagactccttccccaggcgcaaagtctcgtgca
aagctaggaactactccaaaaaataagacgactaaactttcacctggagcaaataaaaag
aggaaattaaccaatactccaaaaaaggagaagaaagatgaagctaaaaatataaatgga
actgagatagtggaaaacattcaagaaaatgatacagttaaaaatgaacgagaaaaatct
attcctcgagatacaaaatataactctgatgaagcaacgaaaatgaaaaataaagtgaaa
aagaaacgggccagaataatcgaaacagattccagcgatgatgatcatttaccgttacct
gaaagtccgaaaaaattagagactaacagcaaagagccaacaccagagaaaaagtcaaag
actacttctaaaaaagtacacagtttttttacatctaaggaaaaagatgatgcaaaggat
acaagtgatgtaaaaaacaataatcagtcttacaatcctagcatatctggttatcatcca
ataaacaatgcgtgctggaaacgaggagataaaactccatacagtgctttcacgcgtact
ttggagcttatcgaagaaacaagtgcaagattgaaaataatagaaatattatcaaattac
ttccgatctgtcatagttctgagccctatggatcttttgccaagcgtgtatttgtgcctt
aatcaattagcaccagcatatgaaggaattgagcttggtgtcgctgatacgaacctgatg
aaggcgattgcgcagtgcactggtaggacgttggcgcaaattaaagccgatgtccaggag
gttggcgatttgggaattgtagcagaaggtagcagatccaatcagagaactatgtttcag
ccggcaccgttgacagttctcgttgtgtactccaaactaaaagaggttgcccaaatgaca
ggccacgcgtctctaacgaaaaaattggacaaaattcaaacgctctttgtggcatgtcgt
aatacggaagcgagatatcttattagatcgttggctggaaagcttcgcatcggtttggcg
gagcaatctgttttgcaagcattggctctagcttgcgccatgacaccaccacaacagagt
tatccaccagaaatcttgaacgcgaataagaatctatcgagcgatcgttttaaacagaaa
tatgacgaaatagcacttatactcaagacaacatattgtgaatgtccaaattataatctc
ataattcccgttttactggaagatggaatcaatggcttgccgagtaagtgcaagctcact
cctggaatacctttgaaacctatgttggcacaccctaccaagggtattcaagaagtccta
acacgatttgagggattaaaattcacgtgcgaatggaaatatgatggagaaagagcacag
atacatgtcgcggacaatggccacatcaatatctacagtcgaaatcaggaaaacaatact
agtaaatacccggatattattaagcgattcaagaatactcgcggcgacctggtgaagaat
tgcatactcgattgcgaggcagttgcttgggacaatgagcaaaaacagattcttccattc
caagtactcagcacgagaaagcgaaaggatgccaacgagaaggacattaaagtgcaagta
tgtgtattcatgttcgacctgttatatctaaacgacgagccgttggtaaaagaatctttt
gcaaaacgtcgcgagttgttgaagcagcatttcaaagaaatagaaggcgagtggaaattt
gccaatagtatggacactactacgatggaggaagtgcaaattttcttggacgaatctgtg
aagggaaattgtgagggtttaatggtgaagacgctcgaggaggaagcaacctatgagatc
gcgaagcgatcgagaaattggttgaagctgaaaaaagattatttggacggtgtgggcgat
acgcttgacgtggttgtaatcggtggttatatcggcaaaggaaagagaacaggcacttat
ggtggctttctcttggcttgctatgatcaagaaaacgaggagtaccagagcatctgtaaa
atcggcacaggcttcaaggaggaagatctggagaatcacacaaagttctttaaggatcat
gtgatatctcaaacgaaatcatattaccgtttcgacagcagtcatgagcccgatcattgg
tttgaaccggtacaagtatgggagattaaatgcgctgatctttccctgtcaccagttcat
agggcagctatcggaatagttgatccggaaaaaggtatttctttaaggtttccgcgattt
atcaggatacgtgaagataaaaattgtgaagaggccacttctgctcagcaggtggcagac
atgtacaataatcaagaacagattaaaaataaaacgtcggcatcaaaagctacggaagaa
gatttctactaa

DBGET integrated database retrieval system