KEGG   Camponotus floridanus (Florida carpenter ant): 105259166Help
Entry
105259166         CDS       T03919                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo03030  DNA replication
cfo03410  Base excision repair
cfo03420  Nucleotide excision repair
cfo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105259166
   03410 Base excision repair
    105259166
   03420 Nucleotide excision repair
    105259166
   03430 Mismatch repair
    105259166
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cfo03032]
    105259166
   03400 DNA repair and recombination proteins [BR:cfo03400]
    105259166
Enzymes [BR:cfo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105259166
    6.5.1.6  DNA ligase (ATP or NAD+)
     105259166
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105259166
DNA replication proteins [BR:cfo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105259166
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105259166
DNA repair and recombination proteins [BR:cfo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105259166
   NER (nucleotide excision repair)
    Other NER factors
     105259166
   MMR (mismatch exicision repair)
    Other MMR factors
     105259166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 105259166
NCBI-ProteinID: XP_025270894
LinkDB All DBs
Position
Unknown
AA seq 936 aa AA seqDB search
MLKILATCSRLSSLTLPVRRFEFANAAHNRFVIVFNWIHATNSNLSDKEKNQDAPGSGKR
KRDSNGFASPPSKKVDKLTKPKSISKTPSPGAKSRAKLGTTPKNKTTKLSPGANKKRKLT
NTPKKEKKDEAKNINGTEIVENIQENDTVKNEREKSIPRDTKYNSDEATKMKNKVKKKRA
RIIETDSSDDDHLPLPESPKKLETNSKEDKIESIDECKIKKNASHDEINEDILDIEEKID
TLKKEPTPEKKSKTTSKKVHSFFTSKEKDDAKDTSDVKNNNQSYNPSISGYHPINNACWK
RGDKTPYSAFTRTLELIEETSARLKIIEILSNYFRSVIVLSPMDLLPSVYLCLNQLAPAY
EGIELGVADTNLMKAIAQCTGRTLAQIKADVQEVGDLGIVAEGSRSNQRTMFQPAPLTVL
VVYSKLKEVAQMTGHASLTKKLDKIQTLFVACRNTEARYLIRSLAGKLRIGLAEQSVLQA
LALACAMTPPQQSYPPEILNANKNLSSDRFKQKYDEIALILKTTYCECPNYNLIIPVLLE
DGINGLPSKCKLTPGIPLKPMLAHPTKGIQEVLTRFEGLKFTCEWKYDGERAQIHVADNG
HINIYSRNQENNTSKYPDIIKRFKNTRGDLVKNCILDCEAVAWDNEQKQILPFQVLSTRK
RKDANEKDIKVQVCVFMFDLLYLNDEPLVKESFAKRRELLKQHFKEIEGEWKFANSMDTT
TMEEVQIFLDESVKGNCEGLMVKTLEEEATYEIAKRSRNWLKLKKDYLDGVGDTLDVVVI
GGYIGKGKRTGTYGGFLLACYDQENEEYQSICKIGTGFKEEDLENHTKFFKDHVISQTKS
YYRFDSSHEPDHWFEPVQVWEIKCADLSLSPVHRAAIGIVDPEKGISLRFPRFIRIREDK
NCEEATSAQQVADMYNNQEQIKNKTSASKATEEDFY
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaattcttgcgacatgctcgcgcttgagctccttgactttaccggttcgacgt
ttcgaattcgcgaacgctgctcataatcgatttgttatcgtttttaattggatacatgca
accaacagcaatttgtccgacaaggaaaagaatcaggatgcaccgggaagcggcaaacgg
aagagagatagcaatggatttgctagccctccttccaagaaggtagacaaacttacgaag
ccaaagtcaatttccaagactccttccccaggcgcaaagtctcgtgcaaagctaggaact
actccaaaaaataagacgactaaactttcacctggagcaaataaaaagaggaaattaacc
aatactccaaaaaaggagaagaaagatgaagctaaaaatataaatggaactgagatagtg
gaaaacattcaagaaaatgatacagttaaaaatgaacgagaaaaatctattcctcgagat
acaaaatataactctgatgaagcaacgaaaatgaaaaataaagtgaaaaagaaacgggcc
agaataatcgaaacagattccagcgatgatgatcatttaccgttacctgaaagtccgaaa
aaattagagactaacagcaaagaagacaagattgaaagtatagatgaatgtaaaataaaa
aagaatgcatcacatgatgaaataaatgaagatattttggatatcgaggaaaagattgat
accttgaaaaaggagccaacaccagagaaaaagtcaaagactacttctaaaaaagtacac
agtttttttacatctaaggaaaaagatgatgcaaaggatacaagtgatgtaaaaaacaat
aatcagtcttacaatcctagcatatctggttatcatccaataaacaatgcgtgctggaaa
cgaggagataaaactccatacagtgctttcacgcgtactttggagcttatcgaagaaaca
agtgcaagattgaaaataatagaaatattatcaaattacttccgatctgtcatagttctg
agccctatggatcttttgccaagcgtgtatttgtgccttaatcaattagcaccagcatat
gaaggaattgagcttggtgtcgctgatacgaacctgatgaaggcgattgcgcagtgcact
ggtaggacgttggcgcaaattaaagccgatgtccaggaggttggcgatttgggaattgta
gcagaaggtagcagatccaatcagagaactatgtttcagccggcaccgttgacagttctc
gttgtgtactccaaactaaaagaggttgcccaaatgacaggccacgcgtctctaacgaaa
aaattggacaaaattcaaacgctctttgtggcatgtcgtaatacggaagcgagatatctt
attagatcgttggctggaaagcttcgcatcggtttggcggagcaatctgttttgcaagca
ttggctctagcttgcgctatgacaccaccacaacagagttatccaccagaaatcttgaac
gcgaataagaatctatcgagcgatcgttttaaacagaaatatgacgaaatagcacttata
ctcaagacaacatattgtgaatgtccaaattataatctcataattcccgttttactggaa
gatggaatcaatggcttgccgagtaagtgcaagctcactcctggaatacctttgaaacct
atgttggcacaccctaccaagggtattcaagaagtcctaacacgatttgagggattaaaa
ttcacgtgcgaatggaaatatgatggagaaagagcacagatacatgtcgcggacaatggc
cacatcaatatctacagtcgaaatcaggaaaacaatactagtaaatacccggatattatt
aagcgattcaagaatactcgcggcgacctggtgaagaattgcatactcgattgcgaggca
gttgcttgggacaatgagcaaaaacagattcttccattccaagtactcagcacgagaaag
cgaaaggatgccaacgagaaggacattaaagtgcaagtatgtgtattcatgttcgacctg
ttatatctaaacgacgagccgttggtaaaagaatcttttgcaaaacgtcgcgagttgttg
aagcagcatttcaaagaaatagaaggcgagtggaaatttgccaatagtatggacactact
acgatggaggaagtgcaaattttcttggacgaatctgtgaagggaaattgtgagggttta
atggtgaagacgctcgaggaggaagcaacctatgagatcgcgaagcgatcgagaaattgg
ttgaagctgaaaaaagattatttggacggtgtgggcgatacgcttgacgtggttgtaatc
ggtggttatatcggcaaaggaaagagaacaggcacttatggtggctttctcttggcttgc
tatgatcaagaaaacgaggagtaccagagcatctgtaaaatcggcacaggcttcaaggag
gaagatctggagaatcacacaaagttctttaaggatcatgtgatatctcaaacgaaatca
tattaccgtttcgacagcagtcatgagcccgatcattggtttgaaccggtacaagtatgg
gagattaaatgcgctgatctttccctgtcaccagttcatagggcagctatcggaatagtt
gatccggaaaaaggtatttctttaaggtttccgcgatttatcaggatacgtgaagataaa
aattgtgaagaggccacttctgctcagcaggtggcagacatgtacaataatcaagaacag
attaaaaataaaacgtcggcatcaaaagctacggaagaagatttctactaa

DBGET integrated database retrieval system