KEGG   Camponotus floridanus (Florida carpenter ant): 105259395Help
Entry
105259395         CDS       T03919                                 

Definition
(RefSeq) probable serine/threonine-protein kinase yakA
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Pathway
cfo03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cfo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    105259395
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cfo03400]
    105259395
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     105259395
DNA repair and recombination proteins [BR:cfo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     105259395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 105259395
NCBI-ProteinID: XP_011269601
LinkDB All DBs
Position
Unknown
AA seq 1092 aa AA seqDB search
MQVATLFRESATLLGASSLDPPQTHHHQGMHQPQQQQQQQQHQQMQQQQHATDMHLVGHH
MQHHYKMSYPSPVQNGGPNGTTTMSCTTSQGVMVKQEARDDGYETSPDLEMRSTGGDSSQ
QYHTPLTPHTPHTPHTPHTPLTPISATAHQPQQPGSTASALGQVAIKCETPVDPYSFVDE
EMSMGGMRTASSPGGGGGGNPENMTCPGGAQPGLGTPTSTPPGALPGPQHHQMNLVMNGA
AGVNPQLAHQPKKRGRKKKSEMILTPEEAELAEAKKRAKTYKERKKHDRFDGMPEEEVSK
RVLPDHLTNNLDIIIIGINPGLFAAYKGHHYAGPGNHFWKCLHLSGLTPEPLTADDDYKL
LRLGIGFTNMVARATKGSADLTRKEIKEGSHILLEKLRKYKPKIAVFNGKLIYEVFSGKK
EFGFGRQPNLVDGTNTYMWVMPSSSARCAQLPRAADKVPYYAALKKFRDYLNGSIPHLDE
SDIVFADSKLKKKDHEAIEDKKPLYIDDLPDGENRITEINGALKQDSGLIPGKKKRGRPK
KIKNPEDQPPPDPEKLDANGEVIKKRRGRPKKIHQQQKQLERETREREQQQQQQQHQAMG
HLNDYGNAVSNCFSPPLMSPPKAFAHMAPYPQPMNDGFYGQGMNDNSPYNMSAKQSPVHM
HYTQSPKSSQSMSLSFTHSDLSSEINTGISSENNLEPSPLTSPSVEHPDFEPPSSMSQQN
MGNDHRQYNPAGGPDPTGHHGSPGTPSHAYANYMGYHDQTPEAHNPHPHQTTPTPLSQTA
EDHSHHSHPTPPHPHTPTHTSMSPHHPHEQYGIKRNSGQDVASKSLSDLESLVDQIPSIA
DGGSQRLQHSHPGMPGDDALAEKMDAHHQSYMSGFGGMPAGPTGMSNYSPPLPPGGGIYP
SSLHHSPNDGVYGSLYGMNGRHHQESQQQQQQQQQQHQQQQQQQHSKSYTVENLASSNYT
PSMNHPGNSYPNIIPGPHYPVPMGSTNGYLFGGLESSLMQRTYGIGGMSGMSGMHPSAAL
GHPMAANPYPYNGSYSSSFDAYPAPPAAIHAPSANYPGYVSAAGAAPTTTTPSSYLAPSH
HRPPVDLSYDGV
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtagcaacgctgttcagggagagcgctaccctgctgggcgcctccagcctggac
cccccgcagactcaccatcatcagggtatgcaccagccgcagcagcagcagcaacagcag
cagcaccagcagatgcagcagcagcagcacgccaccgacatgcacctcgtcggccaccac
atgcagcaccactacaagatgtcgtatccgtcaccggtacagaatggaggaccaaacggc
acgacgacgatgagttgcacgacttctcaaggggtgatggtgaagcaggaggcgagggac
gacggttacgagacgagtccggacctcgagatgaggagcaccggcggtgacagcagtcag
cagtatcacacgccgctgacaccacacacgccgcacacaccgcacacgccgcacacgccc
ctcacgccgatatcggcgacagcgcatcaaccccagcagccgggctcgaccgcctccgcc
ctcggacaggtcgcgataaaatgcgagacgccggtggacccgtactcgttcgtggacgag
gagatgtcgatgggtggcatgaggacggcgagcagtccaggcggcggcggaggcggtaat
cccgagaacatgacgtgtccgggcggtgcccaacctggactgggtacacccacgtcgacg
ccgcccggggcgctgcccgggccacaacatcatcagatgaatctcgtgatgaacggcgcc
gccggcgtcaatccccagctggcgcatcagccgaagaagcgaggccgcaaaaaaaagtcg
gagatgatactcacccccgaggaagcggagcttgcggaggccaagaaacgcgcaaagacg
tacaaagagaggaagaagcacgacaggttcgacggcatgccggaagaggaagtgagcaag
cgcgttttgccggatcatctcaccaacaaccttgacattattataattggtatcaatccc
ggattatttgcggcatacaaaggacatcactatgctgggcctggaaatcacttctggaaa
tgtctacatttgagcggtctcacgcccgagccattgacagcggacgacgattacaagctt
ttgcgcctgggcatcggttttacaaatatggtagcacgtgcgacgaaaggcagtgcggat
ctcacaagaaaggaaattaaagaaggaagtcacattctgctcgagaaattacgaaaatac
aagccaaaaatcgccgtgttcaacggcaaactcatatacgaggtgttctcgggaaagaag
gagtttggattcggaagacagcctaatctcgtcgacggcacaaacacgtacatgtgggtg
atgccttcgagcagcgcgaggtgtgcccagttaccacgggctgccgacaaggtgccatat
tacgcggccctgaagaagttccgcgactatctgaacggctcgatcccgcatctggatgag
tcggacatcgtgttcgccgattcgaaactcaagaagaaggatcatgaagcgatcgaggac
aagaagccactgtacattgacgacttgcccgatggcgagaaccgaatcacggagatcaac
ggtgcgctgaaacaggactcgggcctgatacccggcaagaaaaagcgcggcagaccgaag
aagattaagaacccggaagatcagccgccaccggatcccgagaagttggacgcgaacggg
gaggtcatcaagaagcgtcgcggtcgcccgaagaagatacatcagcagcagaagcagttg
gagcgggagactcgcgagagggagcaacagcaacagcagcagcaacatcaggcgatgggt
catctgaacgactacggcaacgccgtgtcgaactgcttctcaccgccgttgatgtccccc
ccgaaagcttttgcgcatatggctccgtatccgcaaccgatgaacgacggcttttacggc
cagggaatgaacgataatagcccgtacaacatgagcgcgaaacagagcccggtacacatg
cactatacccagagtcccaagtcctctcagtccatgtcgctatcgtttacgcattctgac
ctgtcgtcggagatcaatacgggaatatcgtcggagaacaatctcgagccgtcgccacta
acgtcgcccagcgtcgaacatccggactttgagccacccagcagcatgtcgcagcagaac
atgggcaacgaccatcgccagtacaatccggccggtgggcccgatccaaccggtcatcac
ggtagtcccggcacgccgtctcacgcctatgccaattatatgggctaccacgatcagacg
ccggaggcgcataatccgcatccgcatcaaacgacgccgacgcccctcagccagaccgcc
gaagaccactctcatcactcgcatccgacgccgccacatccgcacacgcctacgcacacg
tccatgtcaccgcaccatccgcacgagcagtacggcatcaagaggaattccggccaagat
gtggcgtccaaaagtttgagcgatctggaatccctggtcgatcagatcccgagcatagcc
gacggtggcagtcagcgtctacagcattcgcatccgggtatgccaggcgacgacgctcta
gcggagaagatggatgcccatcatcagtcctacatgtccggtttcggcggcatgccagcc
ggaccgaccgggatgtccaattatagtcccccgttaccgccgggcggcggaatctatccc
agctcgctgcatcactcgccaaacgacggggtttacggaagtctatacggcatgaatggt
cgtcatcatcaggagtctcaacagcagcagcaacagcagcaacaacagcatcaacagcag
cagcagcagcagcacagcaaatcttacacggtggagaatctcgcgtccagtaattacact
cccagcatgaatcatcccggtaactcgtatcccaacatcatacccggaccgcattatcca
gtgccgatgggctccaccaacggctacctgttcggcggcctcgagtccagcctgatgcag
cgaacctacgggatcggcggaatgagcggcatgagcggcatgcacccgtccgccgccctc
ggtcatccgatggcggctaacccgtacccgtacaacggctcatattcgagttccttcgac
gcttatccggcaccaccggcggcgatacacgcgcccagcgccaattatcccggctacgtc
agcgcggctggcgcggcgcccaccaccaccacgccgtcgtcctacctcgcaccgtcgcat
cacagaccgccggtcgacctctcctacgacggtgtatga

DBGET integrated database retrieval system