KEGG   Campylobacter fetus subsp. testudinum pet-3: CR44_03525Help
Entry
CR44_03525        CDS       T03583                                 

Definition
(GenBank) penicillin-binding protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
cfp  Campylobacter fetus subsp. testudinum pet-3
Pathway
cfp00550  Peptidoglycan biosynthesis
cfp01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cfp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CR44_03525
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CR44_03525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cfp01011]
    CR44_03525
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfp03036]
    CR44_03525
Enzymes [BR:cfp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CR44_03525
Peptidoglycan biosynthesis and degradation proteins [BR:cfp01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CR44_03525
Chromosome and associated proteins [BR:cfp03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CR44_03525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: AJB45302
LinkDB All DBs
Position
complement(718761..720581)
Genome map
AA seq 606 aa AA seqDB search
MSGYQSQSKIYVIFSFIVLGIILFLFVIFYRALLDRKLPKLQSSDFDSALRGSIISKDGF
SIASSQKLYKAMVDIRNIDPNKKELFIKLYTLYSGDDPAKIRKILSKKGIVTLSYEIDAK
GAAYLKELARKLYKKKVFIAYQDPKTGIVATQGMSIVESGEKRIYMAEDTLTPAIGYIKK
IEQDGITKVEGVKGIEKVYDNLLSSTQDGITKGPRDLSNTIILSGDAELSKRIDGYNVVL
NTPLKLQKVIEQMATQKLNDLIAKEVVIGVMESKTGKIIALVSTSRYNPSNITINDYQSL
NSTASEYAYEVGSVMKPVIFSLLLRENKVNPLEIINTYGGKYKLGQRTITDSHKNDFLSA
EDIIVESSNVGMIQLVERLSEIDLYNGLLDFGFSKKTGVDLSYEQVGLLPSINELRNKTY
KSTVSYGYGLQATFMQLLNAYNTINNNGVMITPQIASHLEKNGKIYAIKEQDIKTILPIE
TAKIMKRILIKVVESNKGTARKARIQGLSIGGKTGTAHIATSGGYSDKRYNASFFGFVSD
PNGNNYTIGVLVREPMRPYPYYYASWSALPIFKNTVELMVENGYLKPVTTSPTIDQNEQD
NRDILD
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatatcaaagccaaagcaagatctatgtgatcttcagctttatagttttaggg
attatactatttttatttgtaattttttatagagctttgttagatagaaagctaccaaag
ctgcaaagtagtgattttgatagtgctcttagaggttctatcatatcaaaagacggtttt
agcatagctagtagtcaaaaattatacaaagctatggtagatattagaaatatagatcca
aataaaaaagagctttttataaaattatacacgctctacagcggtgatgatccagcaaaa
atcagaaaaatacttagcaaaaaaggtatagtaaccttatcatatgagatagacgccaaa
ggtgcggcgtatcttaaagagttagctagaaaactgtacaaaaaaaaggtatttatagca
tatcaagatccaaaaactggaatagtcgcaactcaaggtatgagcatcgtagaaagcggt
gaaaaacgtatatatatggcagaagacactcttactccagctatcggatatataaaaaag
atagaacaagatggtataaccaaagtagaaggagtaaaaggtatagaaaaagtatatgat
aacctactttcatctacacaagatggtattacaaaaggtccaagagatctatcaaacacc
attatactctcaggtgacgcagaactctcaaaacggattgacgggtataatgtagttcta
aacactccactaaaactccaaaaagtcatagaacagatggcaacacaaaagctaaatgat
cttatagcaaaagaggttgttataggagttatggagagtaaaacagggaaaatcattgca
ttagtttctacttcaagatacaatccatcaaacatcacaataaatgattaccaatcacta
aattcaacagcaagcgaatacgcttatgaagtaggctcagtaatgaaacctgtcatcttc
tctttactacttagagaaaataaagtaaatccgctagagatcataaatacatatggtgga
aaatataagcttggtcaaagaacgataacagatagccataaaaatgattttttaagcgct
gaggatataatagtagaatcatcaaacgtaggtatgatacagctagttgagagattaagc
gagatagatctatataatggacttttggattttggattttctaaaaaaacaggagttgat
ctaagctatgaacaagtcgggttgcttccatctataaatgaacttagaaataaaacatat
aaatcgactgttagctatggatacggacttcaagctacatttatgcagcttttaaatgct
tataatactataaataataatggagttatgataacaccgcaaatcgcaagtcacttagaa
aaaaatggtaaaatatatgcgataaaagagcaagatatcaaaactattttgcctatagaa
actgccaagataatgaaaagaatacttataaaagttgttgaaagtaacaaaggtacagct
agaaaagcacgcatacaaggacttagcataggtggaaaaaccggaaccgctcacatagct
acaagcggaggctatagcgataaacgatataacgcaagcttttttggatttgtaagtgat
ccaaacggaaataactatacgataggcgtactagtaagagagcctatgagaccgtatcct
tactattacgcttcatggagcgctttaccgatatttaaaaacactgttgagttaatggta
gaaaacggttatctaaaaccagttacaacatctcctacaatagatcaaaacgagcaagat
aacagagatatattagactaa

DBGET integrated database retrieval system