KEGG   Campylobacter fetus subsp. testudinum pet-3: CR44_07035Help
Entry
CR44_07035        CDS       T03583                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cfp  Campylobacter fetus subsp. testudinum pet-3
Pathway
cfp00061  Fatty acid biosynthesis
cfp00780  Biotin metabolism
cfp01100  Metabolic pathways
cfp01130  Biosynthesis of antibiotics
cfp01212  Fatty acid metabolism
Module
cfp_M00083  Fatty acid biosynthesis, elongation
cfp_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cfp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CR44_07035
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CR44_07035
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CR44_07035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cfp01004]
    CR44_07035
Enzymes [BR:cfp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CR44_07035
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CR44_07035
Lipid biosynthesis proteins [BR:cfp01004]
 Fatty acid synthase
  Component type
   CR44_07035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AJB45964
UniProt: A0A2S0JDX2
LinkDB All DBs
Position
complement(1415538..1416362)
Genome map
AA seq 274 aa AA seqDB search
MIMNGKKGLIVGVANKMSIAYGIAKACKEQGASLAFTFVSDAIKKRVEPIAAELGSSLIY
ELDVNNKEHLDSLASKIKADFGDIDFIVHAVAYAPKEALEGEFIDTTKEAFDVAMGTSVY
SLISLTKAVLPVLKEGGSVLTLSYLGGAKFVPHYNVMGVAKAALESSVRYLARDLGKKNI
RVNAISAGPIKTLAASGIGDFKMILKWNECNAPLKRNVSIDDVGKSGMYLLSDLASGVTG
EIHYVDAGYNIMGMGDAVVGENGSTVLAWDEFKE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgataatgaacggtaaaaaaggacttatagtcggcgtagcaaataaaatgagcatagct
tatggtatcgcaaaagcgtgtaaagagcaaggagcatctctggcttttactttcgtaagc
gacgctatcaaaaagcgtgttgagcctatcgcagctgagcttggaagctctcttatatat
gagcttgatgtgaataacaaagagcatttagactcattggcaagtaagataaaagctgat
tttggggatatagattttatcgttcatgctgttgcttacgctcctaaagaggcgttagaa
ggtgagtttatagatactacaaaagaagcctttgacgtggctatgggtactagcgtgtat
tcgcttataagccttactaaagctgtcttgcctgtgctaaaagagggtggctcggtgctt
actttaagttatcttggcggagctaagttcgtaccgcattataacgtaatgggtgtagca
aaagcggctcttgagagtagcgtaagataccttgcgcgtgaccttggaaagaaaaatata
agagtaaatgctatatcagcaggtcctataaaaacactagcggctagtggaataggtgat
tttaagatgatactaaaatggaatgaatgtaacgctccactaaaaagaaacgttagtata
gatgacgttggtaaaagcggaatgtatcttttaagcgaccttgctagtggtgttacgggt
gaaattcattacgttgatgcagggtataatataatgggaatgggcgacgcagtagtaggt
gaaaacggctctactgtccttgcatgggatgagtttaaagagtaa

DBGET integrated database retrieval system