KEGG   Citrobacter freundii complex sp. CFNIH3: C2U38_22630
Entry
C2U38_22630       CDS       T06381                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
cfq  Citrobacter freundii complex sp. CFNIH3
Pathway
cfq00052  Galactose metabolism
cfq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C2U38_22630
Enzymes [BR:cfq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     C2U38_22630
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N 2-Hacid_dh_C Methyltransf_25 MTS ADH_zinc_N_2 UDPG_MGDP_dh_N Methyltransf_31 PrmA Pyr_redox_2 ELFV_dehydrog Shikimate_DH Methyltransf_11 CoA_binding 3HCDH_N Methyltransf_12 Met_10 Fer4_4 ThiF
Other DBs
NCBI-ProteinID: AUV28133
UniProt: A0A2I8SBS7
LinkDB
Position
4514268..4515311
AA seq 347 aa
MKSVVIHAEGDVRVEERPIPQLQTDEDVLVKVVSSGLCGSDIPRVFNHGAHYYPITLGHE
FSGYVESYGAGVTDLQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSEMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLAMQCA
RELGAKSITAIDINPQKLALAKELGATYVFNSREMSATEIHSGLENIQFDQLILETAGTP
QTVTLSIEIAGPRAQLALVGTLHHDLALASGVFGQILRKELTILGSWMNYSSPWPGEEWE
TAARLLTEKRLQLEPLIAYSGDAESFASAVKSLNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggcgacgtacgcgttgaagaacgtcccatacca
caactacaaactgatgaagatgtactggtcaaggtggtcagttcagggctttgcggctca
gatattccccgagttttcaatcatggtgctcactattatccaatcacacttgggcatgag
ttcagtggctatgttgagtcttacggcgcgggcgtaaccgatctacaacccggagatgcc
gttgcttgcgtaccgctgctcccctgcttccactgtcctcagtgtgagcgtggatatttc
tcattgtgtaagcaatatcagtttgtcggatcgcgcagcgaaggcggcaatgcagaatat
gtggtggtaaaacgcgccaacctgttccgcctgccttcagaaatgccgattgatgatggc
gcattcattgagcccattaccgttggcctgcatgcttttcacctcgctcagggatgcgaa
ggcaaaaacgtgatcatcgttggtgcaggtactatcggtttactggcaatgcaatgtgct
cgcgaactcggcgcaaaaagcatcacggcgattgatatcaacccgcagaagctggcgtta
gcaaaagaactgggtgcaacctatgtatttaacagtcgggagatgagtgcgaccgagatc
cactccggtctggagaacattcaatttgaccaactcatcctggagactgcgggaacccca
caaactgttactctgtcgatcgaaattgccggacctcgcgctcaactggcattagtcggt
acgctgcatcacgatctggcgctagcttcaggtgtttttgggcaaatattgcgtaaagaa
ttaaccatccttggcagttggatgaactattccagcccatggcctggagaagagtgggaa
accgctgcccgtttactcacggagaaacgcttacagcttgagccgttgattgcctacagt
ggtgatgccgagagctttgccagcgccgtcaagtcactcaatggcgcgccgatgcagggg
aaaattctgctcaaactctcctga

DBGET integrated database retrieval system