KEGG   Camelus ferus (Wild Bactrian camel): 102503460
Entry
102503460         CDS       T02979                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04728  Dopaminergic synapse
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04922  Glucagon signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05152  Tuberculosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102503460 (AKT2)
   04012 ErbB signaling pathway
    102503460 (AKT2)
   04014 Ras signaling pathway
    102503460 (AKT2)
   04015 Rap1 signaling pathway
    102503460 (AKT2)
   04370 VEGF signaling pathway
    102503460 (AKT2)
   04371 Apelin signaling pathway
    102503460 (AKT2)
   04630 JAK-STAT signaling pathway
    102503460 (AKT2)
   04668 TNF signaling pathway
    102503460 (AKT2)
   04066 HIF-1 signaling pathway
    102503460 (AKT2)
   04068 FoxO signaling pathway
    102503460 (AKT2)
   04072 Phospholipase D signaling pathway
    102503460 (AKT2)
   04071 Sphingolipid signaling pathway
    102503460 (AKT2)
   04024 cAMP signaling pathway
    102503460 (AKT2)
   04022 cGMP-PKG signaling pathway
    102503460 (AKT2)
   04151 PI3K-Akt signaling pathway
    102503460 (AKT2)
   04152 AMPK signaling pathway
    102503460 (AKT2)
   04150 mTOR signaling pathway
    102503460 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102503460 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    102503460 (AKT2)
   04218 Cellular senescence
    102503460 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102503460 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102503460 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102503460 (AKT2)
   04613 Neutrophil extracellular trap formation
    102503460 (AKT2)
   04620 Toll-like receptor signaling pathway
    102503460 (AKT2)
   04625 C-type lectin receptor signaling pathway
    102503460 (AKT2)
   04660 T cell receptor signaling pathway
    102503460 (AKT2)
   04662 B cell receptor signaling pathway
    102503460 (AKT2)
   04664 Fc epsilon RI signaling pathway
    102503460 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    102503460 (AKT2)
   04062 Chemokine signaling pathway
    102503460 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102503460 (AKT2)
   04922 Glucagon signaling pathway
    102503460 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    102503460 (AKT2)
   04920 Adipocytokine signaling pathway
    102503460 (AKT2)
   04929 GnRH secretion
    102503460 (AKT2)
   04915 Estrogen signaling pathway
    102503460 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    102503460 (AKT2)
   04917 Prolactin signaling pathway
    102503460 (AKT2)
   04926 Relaxin signaling pathway
    102503460 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    102503460 (AKT2)
   04919 Thyroid hormone signaling pathway
    102503460 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102503460 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102503460 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    102503460 (AKT2)
   04728 Dopaminergic synapse
    102503460 (AKT2)
   04722 Neurotrophin signaling pathway
    102503460 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102503460 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    102503460 (AKT2)
   04213 Longevity regulating pathway - multiple species
    102503460 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102503460 (AKT2)
   05205 Proteoglycans in cancer
    102503460 (AKT2)
   05230 Central carbon metabolism in cancer
    102503460 (AKT2)
   05231 Choline metabolism in cancer
    102503460 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102503460 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102503460 (AKT2)
   05212 Pancreatic cancer
    102503460 (AKT2)
   05225 Hepatocellular carcinoma
    102503460 (AKT2)
   05226 Gastric cancer
    102503460 (AKT2)
   05214 Glioma
    102503460 (AKT2)
   05221 Acute myeloid leukemia
    102503460 (AKT2)
   05220 Chronic myeloid leukemia
    102503460 (AKT2)
   05218 Melanoma
    102503460 (AKT2)
   05211 Renal cell carcinoma
    102503460 (AKT2)
   05215 Prostate cancer
    102503460 (AKT2)
   05213 Endometrial cancer
    102503460 (AKT2)
   05224 Breast cancer
    102503460 (AKT2)
   05222 Small cell lung cancer
    102503460 (AKT2)
   05223 Non-small cell lung cancer
    102503460 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102503460 (AKT2)
   05017 Spinocerebellar ataxia
    102503460 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102503460 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102503460 (AKT2)
   04931 Insulin resistance
    102503460 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102503460 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102503460 (AKT2)
   05135 Yersinia infection
    102503460 (AKT2)
   05152 Tuberculosis
    102503460 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102503460 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    102503460 (AKT2)
   05161 Hepatitis B
    102503460 (AKT2)
   05160 Hepatitis C
    102503460 (AKT2)
   05164 Influenza A
    102503460 (AKT2)
   05162 Measles
    102503460 (AKT2)
   05168 Herpes simplex virus 1 infection
    102503460 (AKT2)
   05163 Human cytomegalovirus infection
    102503460 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102503460 (AKT2)
   05169 Epstein-Barr virus infection
    102503460 (AKT2)
   05165 Human papillomavirus infection
    102503460 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102503460 (AKT2)
   05142 Chagas disease
    102503460 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102503460 (AKT2)
   01524 Platinum drug resistance
    102503460 (AKT2)
   01522 Endocrine resistance
    102503460 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102503460 (AKT2)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102503460 (AKT2)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102503460 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 102503460
NCBI-ProteinID: XP_006177988
LinkDB
Position
9
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSVNWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggaggccccggtacttcctgctgaagagcgatggctccttcattggatacaaggag
cggcccgaagcccccgaccagactctgccccccttaaacaacttctctgttgcagaatgc
cagctgatgaagaccgagagaccacggcccaacacctttgtcatacgctgcctgcagtgg
accacagtcattgagaggaccttccatgtagactctccggatgagagggaggagtggatg
cgggccatccagatggttgccaacagtctcaagcagcggggcccaggtgaggaccccatg
gactacaagtgtggctcccccagcgactcttctgcggctgaggagatggaggtggcagtt
agcaaggctcgggccaaggtgaccatgaacgacttcgactatctcaaactcctgggcaag
ggcacctttggcaaggtcatcctggtgcgggaaaaggccaccggccgctactatgccatg
aagatcctgcggaaggaggttatcatcgccaaggatgaagtcgcccacacagtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtatgccttccag
acccacgaccgcctgtgcttcgtgatggagtatgccaacggcggtgagctgttcttccac
ctgtcccgggagcgcgtcttcacggaggagcgggcccgcttctacggcgcggagatcgtc
tcggccctggagtacctgcactcacgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggcctgtgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggacccctgagtacctggcacctgag
gtgctggaggacaacgactatggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccacgcaccctcggccccgaggccaagtccctg
cttgcggggctgctcaagaaggaccccaagcagaggctcggcggggggcccagtgatgcc
aaggaggtcatggagcacaggttcttcctcagtgtcaactggcaggacgtggtgcagaag
aagctcctgccacccttcaaacctcaggtcacatctgaggttgacacaaggtactttgac
gatgagttcaccgcccagtccatcacgatcacccccccggaccgctatgacagcctgggc
tcgctcgaactggaccagcggacccacttcccccagttctcctattcggccagcatccga
gagtga

KEGG   Camelus ferus (Wild Bactrian camel): 102515350
Entry
102515350         CDS       T02979                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04728  Dopaminergic synapse
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04922  Glucagon signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05152  Tuberculosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102515350 (AKT3)
   04012 ErbB signaling pathway
    102515350 (AKT3)
   04014 Ras signaling pathway
    102515350 (AKT3)
   04015 Rap1 signaling pathway
    102515350 (AKT3)
   04370 VEGF signaling pathway
    102515350 (AKT3)
   04371 Apelin signaling pathway
    102515350 (AKT3)
   04630 JAK-STAT signaling pathway
    102515350 (AKT3)
   04668 TNF signaling pathway
    102515350 (AKT3)
   04066 HIF-1 signaling pathway
    102515350 (AKT3)
   04068 FoxO signaling pathway
    102515350 (AKT3)
   04072 Phospholipase D signaling pathway
    102515350 (AKT3)
   04071 Sphingolipid signaling pathway
    102515350 (AKT3)
   04024 cAMP signaling pathway
    102515350 (AKT3)
   04022 cGMP-PKG signaling pathway
    102515350 (AKT3)
   04151 PI3K-Akt signaling pathway
    102515350 (AKT3)
   04152 AMPK signaling pathway
    102515350 (AKT3)
   04150 mTOR signaling pathway
    102515350 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102515350 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    102515350 (AKT3)
   04218 Cellular senescence
    102515350 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102515350 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102515350 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102515350 (AKT3)
   04613 Neutrophil extracellular trap formation
    102515350 (AKT3)
   04620 Toll-like receptor signaling pathway
    102515350 (AKT3)
   04625 C-type lectin receptor signaling pathway
    102515350 (AKT3)
   04660 T cell receptor signaling pathway
    102515350 (AKT3)
   04662 B cell receptor signaling pathway
    102515350 (AKT3)
   04664 Fc epsilon RI signaling pathway
    102515350 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    102515350 (AKT3)
   04062 Chemokine signaling pathway
    102515350 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102515350 (AKT3)
   04922 Glucagon signaling pathway
    102515350 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    102515350 (AKT3)
   04920 Adipocytokine signaling pathway
    102515350 (AKT3)
   04929 GnRH secretion
    102515350 (AKT3)
   04915 Estrogen signaling pathway
    102515350 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    102515350 (AKT3)
   04917 Prolactin signaling pathway
    102515350 (AKT3)
   04926 Relaxin signaling pathway
    102515350 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    102515350 (AKT3)
   04919 Thyroid hormone signaling pathway
    102515350 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102515350 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102515350 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    102515350 (AKT3)
   04728 Dopaminergic synapse
    102515350 (AKT3)
   04722 Neurotrophin signaling pathway
    102515350 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102515350 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    102515350 (AKT3)
   04213 Longevity regulating pathway - multiple species
    102515350 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102515350 (AKT3)
   05205 Proteoglycans in cancer
    102515350 (AKT3)
   05230 Central carbon metabolism in cancer
    102515350 (AKT3)
   05231 Choline metabolism in cancer
    102515350 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102515350 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102515350 (AKT3)
   05212 Pancreatic cancer
    102515350 (AKT3)
   05225 Hepatocellular carcinoma
    102515350 (AKT3)
   05226 Gastric cancer
    102515350 (AKT3)
   05214 Glioma
    102515350 (AKT3)
   05221 Acute myeloid leukemia
    102515350 (AKT3)
   05220 Chronic myeloid leukemia
    102515350 (AKT3)
   05218 Melanoma
    102515350 (AKT3)
   05211 Renal cell carcinoma
    102515350 (AKT3)
   05215 Prostate cancer
    102515350 (AKT3)
   05213 Endometrial cancer
    102515350 (AKT3)
   05224 Breast cancer
    102515350 (AKT3)
   05222 Small cell lung cancer
    102515350 (AKT3)
   05223 Non-small cell lung cancer
    102515350 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102515350 (AKT3)
   05017 Spinocerebellar ataxia
    102515350 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102515350 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102515350 (AKT3)
   04931 Insulin resistance
    102515350 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102515350 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102515350 (AKT3)
   05135 Yersinia infection
    102515350 (AKT3)
   05152 Tuberculosis
    102515350 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102515350 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    102515350 (AKT3)
   05161 Hepatitis B
    102515350 (AKT3)
   05160 Hepatitis C
    102515350 (AKT3)
   05164 Influenza A
    102515350 (AKT3)
   05162 Measles
    102515350 (AKT3)
   05168 Herpes simplex virus 1 infection
    102515350 (AKT3)
   05163 Human cytomegalovirus infection
    102515350 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102515350 (AKT3)
   05169 Epstein-Barr virus infection
    102515350 (AKT3)
   05165 Human papillomavirus infection
    102515350 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102515350 (AKT3)
   05142 Chagas disease
    102515350 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102515350 (AKT3)
   01524 Platinum drug resistance
    102515350 (AKT3)
   01522 Endocrine resistance
    102515350 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102515350 (AKT3)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102515350 (AKT3)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102515350 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2
Other DBs
NCBI-GeneID: 102515350
NCBI-ProteinID: XP_032322426
LinkDB
Position
23
AA seq 514 aa
MNRVANLCVCVLQFRKISLPSPPIIWDKNPSPSEAGERICDPRVPSRRWRGEYIKNWRPR
YFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIER
TFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTM
NDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRH
PFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSG
KIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGR
AVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDP
NKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTIT
ITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgaacagagttgcaaacctgtgtgtctgtgtgctgcaattcaggaaaatttctctcccc
tcacctcctattatttgggataaaaaccccagccccagtgaagctggcgagcggatatgt
gacccaagagttccttcaaggagatggagaggagaatatataaaaaactggaggccaaga
tatttccttttgaagacagatggctcattcataggatataaagagaaaccccaagatgtg
gatttaccttatcccctcaacaacttttcagtggcaaaatgccagttaatgaaaacagaa
cgaccaaagccaaacacatttattatcagatgtctccagtggaccactgttatagagaga
acatttcatgtagatactccagaggaaagggaagaatggacagaagctattcaggctgta
gcagacagacttcagaggcaagaagaagagagaatgaattgtagtccaacttcacaaatt
gataatataggggaggaagagatggatgcttctacaactcatcataaaagaaagacaatg
aatgattttgactatttgaaactgctaggtaaaggcacttttgggaaagttattttggtt
cgagagaaggcaagtgggaaatactatgctatgaagattctgaagaaagaagttattatt
gccaaggatgaagtggcacacactttaactgaaagcagagtattaaagaacactagacat
ccctttttaacatccttgaaatactccttccagacaaaagaccgtttgtgttttgtgatg
gaatatgttaatggcggagagctgtttttccatttgtcgagagagcgggtgttctctgag
gaccgcacacgtttctatggtgcagaaattgtctctgccttggactatctacattccgga
aagattgtgtaccgtgatctcaagttggagaatttgatgctggataaagatggccacata
aaaattacagattttggactttgcaaagaagggatcacagatgcagccaccatgaagacg
ttctgtggcacaccagagtatctggcaccagaggtgttagaagataatgactatggccga
gccgtggattggtggggccttggggttgttatgtatgaaatgatgtgtgggcggttgccc
ttctacaaccaggatcatgagaaactttttgaactaattctaatggaagacattaaattt
cctcgaacactctcttcagatgcaaaatcattgctttcagggctcttgataaaggatcca
aataaacgccttggtggaggaccagatgatgcaaaagaaattatgagacacagtttcttt
tctggagtaaactggcaagatgtatatgataaaaagcttgtacctccttttaaacctcaa
gtaacatcagagacagacaccagatattttgatgaagaatttacagctcagactattaca
ataacaccaccagaaaaatatgatgaggacggcatggactgcatggacaatgagagacgg
ccgcacttccctcagttttcctactctgcaagtggccgggaatag

KEGG   Camelus ferus (Wild Bactrian camel): 102519101
Entry
102519101         CDS       T02979                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04728  Dopaminergic synapse
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04922  Glucagon signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05152  Tuberculosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102519101
   04012 ErbB signaling pathway
    102519101
   04014 Ras signaling pathway
    102519101
   04015 Rap1 signaling pathway
    102519101
   04370 VEGF signaling pathway
    102519101
   04371 Apelin signaling pathway
    102519101
   04630 JAK-STAT signaling pathway
    102519101
   04668 TNF signaling pathway
    102519101
   04066 HIF-1 signaling pathway
    102519101
   04068 FoxO signaling pathway
    102519101
   04072 Phospholipase D signaling pathway
    102519101
   04071 Sphingolipid signaling pathway
    102519101
   04024 cAMP signaling pathway
    102519101
   04022 cGMP-PKG signaling pathway
    102519101
   04151 PI3K-Akt signaling pathway
    102519101
   04152 AMPK signaling pathway
    102519101
   04150 mTOR signaling pathway
    102519101
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102519101
  09143 Cell growth and death
   04210 Apoptosis
    102519101
   04218 Cellular senescence
    102519101
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102519101
   04550 Signaling pathways regulating pluripotency of stem cells
    102519101
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102519101
   04613 Neutrophil extracellular trap formation
    102519101
   04620 Toll-like receptor signaling pathway
    102519101
   04625 C-type lectin receptor signaling pathway
    102519101
   04660 T cell receptor signaling pathway
    102519101
   04662 B cell receptor signaling pathway
    102519101
   04664 Fc epsilon RI signaling pathway
    102519101
   04666 Fc gamma R-mediated phagocytosis
    102519101
   04062 Chemokine signaling pathway
    102519101
  09152 Endocrine system
   04910 Insulin signaling pathway
    102519101
   04922 Glucagon signaling pathway
    102519101
   04923 Regulation of lipolysis in adipocytes
    102519101
   04920 Adipocytokine signaling pathway
    102519101
   04929 GnRH secretion
    102519101
   04915 Estrogen signaling pathway
    102519101
   04914 Progesterone-mediated oocyte maturation
    102519101
   04917 Prolactin signaling pathway
    102519101
   04926 Relaxin signaling pathway
    102519101
   04935 Growth hormone synthesis, secretion and action
    102519101
   04919 Thyroid hormone signaling pathway
    102519101
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102519101
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102519101
  09156 Nervous system
   04725 Cholinergic synapse
    102519101
   04728 Dopaminergic synapse
    102519101
   04722 Neurotrophin signaling pathway
    102519101
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102519101
  09149 Aging
   04211 Longevity regulating pathway
    102519101
   04213 Longevity regulating pathway - multiple species
    102519101
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102519101
   05205 Proteoglycans in cancer
    102519101
   05230 Central carbon metabolism in cancer
    102519101
   05231 Choline metabolism in cancer
    102519101
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102519101
  09162 Cancer: specific types
   05210 Colorectal cancer
    102519101
   05212 Pancreatic cancer
    102519101
   05225 Hepatocellular carcinoma
    102519101
   05226 Gastric cancer
    102519101
   05214 Glioma
    102519101
   05221 Acute myeloid leukemia
    102519101
   05220 Chronic myeloid leukemia
    102519101
   05218 Melanoma
    102519101
   05211 Renal cell carcinoma
    102519101
   05215 Prostate cancer
    102519101
   05213 Endometrial cancer
    102519101
   05224 Breast cancer
    102519101
   05222 Small cell lung cancer
    102519101
   05223 Non-small cell lung cancer
    102519101
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102519101
   05017 Spinocerebellar ataxia
    102519101
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102519101
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102519101
   04931 Insulin resistance
    102519101
   04933 AGE-RAGE signaling pathway in diabetic complications
    102519101
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102519101
   05135 Yersinia infection
    102519101
   05152 Tuberculosis
    102519101
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102519101
   05170 Human immunodeficiency virus 1 infection
    102519101
   05161 Hepatitis B
    102519101
   05160 Hepatitis C
    102519101
   05164 Influenza A
    102519101
   05162 Measles
    102519101
   05168 Herpes simplex virus 1 infection
    102519101
   05163 Human cytomegalovirus infection
    102519101
   05167 Kaposi sarcoma-associated herpesvirus infection
    102519101
   05169 Epstein-Barr virus infection
    102519101
   05165 Human papillomavirus infection
    102519101
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102519101
   05142 Chagas disease
    102519101
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102519101
   01524 Platinum drug resistance
    102519101
   01522 Endocrine resistance
    102519101
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102519101
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102519101
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102519101
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C Pkinase_fungal APH Seadorna_VP7
Other DBs
NCBI-GeneID: 102519101
NCBI-ProteinID: XP_032330052
LinkDB
Position
35
AA seq 475 aa
MSDVTIVKEGWVQKRGKYIKTWRPRYFLLKTDGSFIGYKEKPQHGDLPDPLNNFSVAKCQ
LMKTERPKPNTFIIRFLQATTVIERTFQVDTPEEREEWAEAIQAVADRLQRQEEERVSSQ
NDNIGEEEMGASATHHKRKTMNDFDYLKLLGKGTFGRVILVLEKASGKYCAMKILKKEFI
IAKDLVAQTLTESRVLKDIRHPFLTALKYSFQTKDRLCFVMEYLSGGDLFFHLSRERVFS
EDHTHFYGAETVSAFDYLHSRKIVHRDLKLENLMLDKDGHIKITDFGFCKEGITDAATMS
TICGTPEYMAPEVLKDNDYGRAVDWWGLGVVMYEMMCGEVPFYNEDHEKLFDLIVMEDVK
FPQTLSLDAKSLLSGLLIKDPNKRLGGGPDDGKEIMRHSFFSGVNWQDVYDKKLVPPFKP
QVTSEADTRYFDEEFTAQNITITPPEKYDEDGMDCTDSERQPQFPQFSYSASGPE
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggaaaatacataaaa
acctggaggccaaggtatttccttttgaagacagatggctcattcataggctataaagag
aaaccccaacatggggatttacctgatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccgaaaccaaacacatttattatcagatttctccaggcgacc
actgttatagagagaacatttcaagtagatactccagaggaaagggaagaatgggcagaa
gctattcaggctgtagcagacagacttcagaggcaagaagaagagagagtgagttcacaa
aatgataatataggggaggaagagatgggtgcttctgcaactcaccataaaagaaagaca
atgaatgattttgactatttgaaactgctaggtaaaggcacttttgggagagttattttg
gttctagagaaggcaagtgggaaatactgtgctatgaagattctgaagaaagaatttata
attgccaaggatctagtggcacaaactttaactgaaagcagagtattaaaggacattaga
catccctttttaacagccttgaaatactccttccagacaaaagaccgtttgtgttttgtg
atggaatatcttagtggaggagacctgtttttccatttgtcgagagagcgggtgttctct
gaggaccacacacatttctatggtgcagaaactgtctctgcctttgactatctgcattcc
agaaagattgtgcaccgtgacctcaagttggagaatttgatgctggataaagatggccac
ataaaaattacagattttggattttgcaaagaagggatcacagatgcagccaccatgagt
acaatctgtggtacaccagaatacatggcaccagaggtgttaaaagataatgactatggc
cgagctgtggattggtggggccttggggttgttatgtatgaaatgatgtgtggggaggtg
cctttctacaacgaggatcatgagaaactttttgacctaattgtaatggaagacgttaaa
tttcctcaaacactctctttagatgcaaaatcattgctttcagggctcttgataaaggat
ccaaataaacgccttggtggaggaccagatgatggaaaagaaattatgagacacagtttc
ttttctggagtaaactggcaagatgtatatgataaaaagttggtacctccttttaaacct
caagtaacatcagaggcagacaccagatattttgatgaagaatttacagcccagaatatt
acaataacaccacctgaaaaatatgatgaggacggcatggactgcacagacagtgagaga
cagccgcaattccctcagttttcctactctgcaagtggccctgaatag

KEGG   Camelus ferus (Wild Bactrian camel): 106729149
Entry
106729149         CDS       T02979                                 

Gene name
AKT1
Definition
(RefSeq) LOW QUALITY PROTEIN: RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04218  Cellular senescence
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04380  Osteoclast differentiation
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04620  Toll-like receptor signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04668  TNF signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr04725  Cholinergic synapse
cfr04728  Dopaminergic synapse
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04922  Glucagon signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr04926  Relaxin signaling pathway
cfr04929  GnRH secretion
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr04973  Carbohydrate digestion and absorption
cfr05010  Alzheimer disease
cfr05017  Spinocerebellar ataxia
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05152  Tuberculosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106729149 (AKT1)
   04012 ErbB signaling pathway
    106729149 (AKT1)
   04014 Ras signaling pathway
    106729149 (AKT1)
   04015 Rap1 signaling pathway
    106729149 (AKT1)
   04370 VEGF signaling pathway
    106729149 (AKT1)
   04371 Apelin signaling pathway
    106729149 (AKT1)
   04630 JAK-STAT signaling pathway
    106729149 (AKT1)
   04668 TNF signaling pathway
    106729149 (AKT1)
   04066 HIF-1 signaling pathway
    106729149 (AKT1)
   04068 FoxO signaling pathway
    106729149 (AKT1)
   04072 Phospholipase D signaling pathway
    106729149 (AKT1)
   04071 Sphingolipid signaling pathway
    106729149 (AKT1)
   04024 cAMP signaling pathway
    106729149 (AKT1)
   04022 cGMP-PKG signaling pathway
    106729149 (AKT1)
   04151 PI3K-Akt signaling pathway
    106729149 (AKT1)
   04152 AMPK signaling pathway
    106729149 (AKT1)
   04150 mTOR signaling pathway
    106729149 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106729149 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    106729149 (AKT1)
   04218 Cellular senescence
    106729149 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106729149 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    106729149 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106729149 (AKT1)
   04613 Neutrophil extracellular trap formation
    106729149 (AKT1)
   04620 Toll-like receptor signaling pathway
    106729149 (AKT1)
   04625 C-type lectin receptor signaling pathway
    106729149 (AKT1)
   04660 T cell receptor signaling pathway
    106729149 (AKT1)
   04662 B cell receptor signaling pathway
    106729149 (AKT1)
   04664 Fc epsilon RI signaling pathway
    106729149 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    106729149 (AKT1)
   04062 Chemokine signaling pathway
    106729149 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106729149 (AKT1)
   04922 Glucagon signaling pathway
    106729149 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    106729149 (AKT1)
   04920 Adipocytokine signaling pathway
    106729149 (AKT1)
   04929 GnRH secretion
    106729149 (AKT1)
   04915 Estrogen signaling pathway
    106729149 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    106729149 (AKT1)
   04917 Prolactin signaling pathway
    106729149 (AKT1)
   04926 Relaxin signaling pathway
    106729149 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    106729149 (AKT1)
   04919 Thyroid hormone signaling pathway
    106729149 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106729149 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106729149 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    106729149 (AKT1)
   04728 Dopaminergic synapse
    106729149 (AKT1)
   04722 Neurotrophin signaling pathway
    106729149 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106729149 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    106729149 (AKT1)
   04213 Longevity regulating pathway - multiple species
    106729149 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106729149 (AKT1)
   05205 Proteoglycans in cancer
    106729149 (AKT1)
   05230 Central carbon metabolism in cancer
    106729149 (AKT1)
   05231 Choline metabolism in cancer
    106729149 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106729149 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106729149 (AKT1)
   05212 Pancreatic cancer
    106729149 (AKT1)
   05225 Hepatocellular carcinoma
    106729149 (AKT1)
   05226 Gastric cancer
    106729149 (AKT1)
   05214 Glioma
    106729149 (AKT1)
   05221 Acute myeloid leukemia
    106729149 (AKT1)
   05220 Chronic myeloid leukemia
    106729149 (AKT1)
   05218 Melanoma
    106729149 (AKT1)
   05211 Renal cell carcinoma
    106729149 (AKT1)
   05215 Prostate cancer
    106729149 (AKT1)
   05213 Endometrial cancer
    106729149 (AKT1)
   05224 Breast cancer
    106729149 (AKT1)
   05222 Small cell lung cancer
    106729149 (AKT1)
   05223 Non-small cell lung cancer
    106729149 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106729149 (AKT1)
   05017 Spinocerebellar ataxia
    106729149 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106729149 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106729149 (AKT1)
   04931 Insulin resistance
    106729149 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    106729149 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106729149 (AKT1)
   05135 Yersinia infection
    106729149 (AKT1)
   05152 Tuberculosis
    106729149 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106729149 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    106729149 (AKT1)
   05161 Hepatitis B
    106729149 (AKT1)
   05160 Hepatitis C
    106729149 (AKT1)
   05164 Influenza A
    106729149 (AKT1)
   05162 Measles
    106729149 (AKT1)
   05168 Herpes simplex virus 1 infection
    106729149 (AKT1)
   05163 Human cytomegalovirus infection
    106729149 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106729149 (AKT1)
   05169 Epstein-Barr virus infection
    106729149 (AKT1)
   05165 Human papillomavirus infection
    106729149 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106729149 (AKT1)
   05142 Chagas disease
    106729149 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106729149 (AKT1)
   01524 Platinum drug resistance
    106729149 (AKT1)
   01522 Endocrine resistance
    106729149 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    106729149 (AKT1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106729149 (AKT1)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   106729149 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 106729149
NCBI-ProteinID: XP_032338710
LinkDB
Position
6
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFTGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTAAIQTVADGLKRQEEELMDF
RSGSPSENSGAEDMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPRQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMEGMDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaatgacgtggccatcgtgaaggagggctggctgcacaaacgaggggagtacatcaaa
acctggcggccccggtacttcctcctcaagagtgacggcaccttcaccggctacaaggag
cggccacaggacgtggagcagcgcgagtcgcccctcaacaacttctccgtggcacaatgc
cagctgatgaagacagagcggccacggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcatcgagcgcaccttccacgtggagacacccgaggagcgggaggagtggacg
gccgccatccagacagtggccgacgggctcaagaggcaggaggaggagctgatggacttc
cggtcgggctcgcccagcgagaactcgggggctgaggacatggaggtttctctggccaag
cccaagcaccgcgtgaccatgaatgagtttgagtacctgaagctgctaggcaagggcacc
ttcgggaaggtgatcctggtgaaggagaaggccaccggccgctactacgccatgaagatc
ttgaagaaggaggtcattgtggccaaggacgaggtggcccacacactcacagagaaccgt
gtcctccagaactcccggcaccccttcctgacggccctgaagtactccttccagacccat
gaccgcctgtgcttcgtcatggagtatgccaatggcggtgagctcttcttccacctgtcc
cgggagcgggtgttccccgaggaccgggcgcgcttctatggcgctgagatcgtgtcggca
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcaccgacttcgggctgtgcaaggagggcatc
aaggacggcgccaccatgaagaccttctgcgggacgcccgagtacctggcccccgaggtg
ctggaggacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctgttcgagctc
atcctcatggaggaaatccgattcccgcgcacgctcggccccgaggccaagtccctgctc
tcggggctgctcaagaaggaccccaggcagcggctcggcgggggctccgaggacgccaag
gagatcatgcagcaccgcttctttgccagcatcgtgtggcaggacgtgtacgagaagaag
ctcagtccgcccttcaagccgcaggtcacatcagagacggacactaggtattttgatgag
gagttcacagcccagatgatcaccatcacgccacctgaccaagatgacagcatggagggc
atggacagtgagcggaggcctcacttcccccagttctcctactcagccagcggcacggcc
tga

DBGET integrated database retrieval system