KEGG   Camelus ferus (Wild Bactrian camel): 102503497
Entry
102503497         CDS       T02979                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01523  Antifolate resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04062  Chemokine signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04068  FoxO signaling pathway
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04380  Osteoclast differentiation
cfr04620  Toll-like receptor signaling pathway
cfr04621  NOD-like receptor signaling pathway
cfr04622  RIG-I-like receptor signaling pathway
cfr04623  Cytosolic DNA-sensing pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04657  IL-17 signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04668  TNF signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr05010  Alzheimer disease
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05212  Pancreatic cancer
cfr05215  Prostate cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102503497 (CHUK)
   04014 Ras signaling pathway
    102503497 (CHUK)
   04064 NF-kappa B signaling pathway
    102503497 (CHUK)
   04668 TNF signaling pathway
    102503497 (CHUK)
   04068 FoxO signaling pathway
    102503497 (CHUK)
   04151 PI3K-Akt signaling pathway
    102503497 (CHUK)
   04150 mTOR signaling pathway
    102503497 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102503497 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102503497 (CHUK)
   04621 NOD-like receptor signaling pathway
    102503497 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    102503497 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    102503497 (CHUK)
   04625 C-type lectin receptor signaling pathway
    102503497 (CHUK)
   04660 T cell receptor signaling pathway
    102503497 (CHUK)
   04658 Th1 and Th2 cell differentiation
    102503497 (CHUK)
   04659 Th17 cell differentiation
    102503497 (CHUK)
   04657 IL-17 signaling pathway
    102503497 (CHUK)
   04662 B cell receptor signaling pathway
    102503497 (CHUK)
   04062 Chemokine signaling pathway
    102503497 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102503497 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102503497 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102503497 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102503497 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102503497 (CHUK)
   05221 Acute myeloid leukemia
    102503497 (CHUK)
   05220 Chronic myeloid leukemia
    102503497 (CHUK)
   05215 Prostate cancer
    102503497 (CHUK)
   05222 Small cell lung cancer
    102503497 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102503497 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102503497 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102503497 (CHUK)
   05135 Yersinia infection
    102503497 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102503497 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    102503497 (CHUK)
   05161 Hepatitis B
    102503497 (CHUK)
   05160 Hepatitis C
    102503497 (CHUK)
   05171 Coronavirus disease - COVID-19
    102503497 (CHUK)
   05164 Influenza A
    102503497 (CHUK)
   05162 Measles
    102503497 (CHUK)
   05168 Herpes simplex virus 1 infection
    102503497 (CHUK)
   05163 Human cytomegalovirus infection
    102503497 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102503497 (CHUK)
   05169 Epstein-Barr virus infection
    102503497 (CHUK)
   05165 Human papillomavirus infection
    102503497 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102503497 (CHUK)
   05142 Chagas disease
    102503497 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102503497 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102503497 (CHUK)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102503497 (CHUK)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102503497 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 102503497
NCBI-ProteinID: XP_032346993
LinkDB
Position
11
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHVNKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIVSFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMKEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPQVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQASAWLPPTSAEREHPLSCVVTPQDGETLAQMIEENLNCLGHL
STIIHEANEKQGNSLMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgagagcga
ctgggtacaggcggcttcgggaacgtctgcctataccagcatcgggaacttgatctcaaa
atagcaattaaatcttgtcgcctggagctcagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtgaaggcctgtgatgttcct
gaggaattgaattttttgattaatgatgtgcctcttctagcaatggagtattgttctgga
ggagatctccggaagctactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatataggatctgggatccgatatttgcatgtaaacaaaatt
atacatcgtgatttaaaaccagaaaatatagttcttcaggatgttggtggaaagattatg
cataaaattattgacctgggatacgccaaagatgttgatcaaggaagtctgtgtacatct
ttcgtgggaacattgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtgtttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagaaatgtcaggagaagttcgatttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttgatgctg
aattgggatcctcagcagagaggaggacctgtcgatcttactttgaagcagccaagatgt
tttgtattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagatagtttcttttttgttgccacctgatgagagtcttcattcactgcagtctcgt
attgagcgtgaaactggaataaatactggttctcaagagcttctttcagagaccggaatt
tctctggatcctcgaaaaccagcctctcaatgtgttctggatggagtcaggggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggaccgtttgcttct
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtatgggcggaagcagtgcactatgtgtctgggctaaaagaagac
tacagcaggctctttcagggacagagagcagcgatgttaagtcttcttagatataatgct
aacttgacaaaaatgaagaacactttgatctcagcatctcagcagctgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgagcagatgacttat
gggatatcctcagaaaaaatgttaaaagcatggaaagaaatgaaagaaaaggctatccac
tatgctgaggtcggtgtcattggatacttggaggatcagatcatgtctctgcacactgaa
atcatggagctacagaagagcccctatggacgacgtcagggagacttgatggaatctctg
gaacagcgcgccattgatctatataagcagttgaagcacagaccttcagatcactcctac
agcgacagcacggagatggtgaaaatcattgtgcatactgtgcagagtcaggaccgggtt
ctcaaagagctgtttggtcatctgagcaagttgttgggctgtaaacagaagattattgat
ctgctgccccaagtggaaatggccctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccgatcccttgtaggatccagtctagaaggtgcagtaacccctcaggcctca
gcatggctgcctccaacttcagcagaacgtgaacatcctctgtcatgcgtggtaactcct
caagatggggagactttagcacaaatgatagaagagaatttgaactgtcttggccattta
agcactattattcatgaggcaaatgagaaacaaggcaatagtttgatgaatcttgattgg
agttggttaacagaatga

KEGG   Camelus ferus (Wild Bactrian camel): 102508142
Entry
102508142         CDS       T02979                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01523  Antifolate resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04062  Chemokine signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04068  FoxO signaling pathway
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04380  Osteoclast differentiation
cfr04620  Toll-like receptor signaling pathway
cfr04621  NOD-like receptor signaling pathway
cfr04622  RIG-I-like receptor signaling pathway
cfr04623  Cytosolic DNA-sensing pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04657  IL-17 signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04668  TNF signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr04910  Insulin signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04930  Type II diabetes mellitus
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr05010  Alzheimer disease
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05212  Pancreatic cancer
cfr05215  Prostate cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102508142 (IKBKB)
   04014 Ras signaling pathway
    102508142 (IKBKB)
   04064 NF-kappa B signaling pathway
    102508142 (IKBKB)
   04668 TNF signaling pathway
    102508142 (IKBKB)
   04068 FoxO signaling pathway
    102508142 (IKBKB)
   04151 PI3K-Akt signaling pathway
    102508142 (IKBKB)
   04150 mTOR signaling pathway
    102508142 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102508142 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102508142 (IKBKB)
   04621 NOD-like receptor signaling pathway
    102508142 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    102508142 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    102508142 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    102508142 (IKBKB)
   04660 T cell receptor signaling pathway
    102508142 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    102508142 (IKBKB)
   04659 Th17 cell differentiation
    102508142 (IKBKB)
   04657 IL-17 signaling pathway
    102508142 (IKBKB)
   04662 B cell receptor signaling pathway
    102508142 (IKBKB)
   04062 Chemokine signaling pathway
    102508142 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102508142 (IKBKB)
   04920 Adipocytokine signaling pathway
    102508142 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102508142 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102508142 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102508142 (IKBKB)
   05206 MicroRNAs in cancer
    102508142 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102508142 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102508142 (IKBKB)
   05221 Acute myeloid leukemia
    102508142 (IKBKB)
   05220 Chronic myeloid leukemia
    102508142 (IKBKB)
   05215 Prostate cancer
    102508142 (IKBKB)
   05222 Small cell lung cancer
    102508142 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102508142 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102508142 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102508142 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    102508142 (IKBKB)
   04931 Insulin resistance
    102508142 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102508142 (IKBKB)
   05135 Yersinia infection
    102508142 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102508142 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    102508142 (IKBKB)
   05161 Hepatitis B
    102508142 (IKBKB)
   05160 Hepatitis C
    102508142 (IKBKB)
   05171 Coronavirus disease - COVID-19
    102508142 (IKBKB)
   05164 Influenza A
    102508142 (IKBKB)
   05162 Measles
    102508142 (IKBKB)
   05168 Herpes simplex virus 1 infection
    102508142 (IKBKB)
   05163 Human cytomegalovirus infection
    102508142 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102508142 (IKBKB)
   05169 Epstein-Barr virus infection
    102508142 (IKBKB)
   05165 Human papillomavirus infection
    102508142 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102508142 (IKBKB)
   05142 Chagas disease
    102508142 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102508142 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102508142 (IKBKB)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102508142 (IKBKB)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102508142 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Glyco_hydro_65m Med20
Other DBs
NCBI-GeneID: 102508142
NCBI-ProteinID: XP_006188447
LinkDB
Position
26
AA seq 754 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQSLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
TDIVVSEDLNGTVKFSSSLPYPNNLNSILAQRLEKWLQLMLTWHPRQRGTDPVYGPNGCF
KALDDILNLKLAHVLNMVTGTIHTYPVTEDESLQSLKARIQEDTGIAEEDQELLQEAGLA
LIPDKPAAQCISDGKLNEGRTLDMDLVFLFDNSRVTYETQVSPRPQPESVSCILQEPKRN
LPFFQLRRVWGQVWHSIQALKEDCSRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYNEQTEFGITSDKLQLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKMVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHPGQLMSQPCTAPDSEAVKKSEELVAEAHTLCTQLENA
LQDTMKEQDQSLRSLDWSWLQTAEEEQNGLEQAS
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgagctggtcgccttccctgccgacccagacatgtggggcctgggaaatgaaagagcgt
ctggggacagggggatttgggaacgtcatccgatggcacaatcaggaaacaggtgagcag
atcgctatcaagcagtgccggcaggagctcagtccccggaaccgagagcgatggtgcctg
gagatccagatcatgagaaggctgaaccaccccaacgtggtggccgcccgagacgtccct
gaggggatgcagagcctggcccccaacgacctgcccctgctggccatggagtactgccag
gggggcgacctgcgcaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccatcctcaccttgctgagtgacattgcctctgcgcttcgataccttcatgaaaacaga
atcatccatcgggatctgaagccagaaaacatcgtcctgcaacaaggggagcagaggtta
atacacaaaattattgacctcggatacgccaaggagctggatcagggcagtctctgtacg
tcctttgtggggaccctgcagtacctggccccggagctgctggagcagcagaagtacacg
gtcaccgttgactactggagcttcggcaccctggccttcgagtgcatcacgggcttccgg
cccttcctgcccaactggcagcccgtgcagtggcactccaaagtccggcagaagagcgag
acggacattgtggttagcgaagacctgaacgggacggtcaagttctcaagctctctgccc
taccccaacaacctcaacagcatcctggcgcagcggctagagaagtggctgcagctgatg
ctaacgtggcacccccggcagaggggcaccgaccccgtctacgggcccaacggctgcttc
aaggccctggatgatatcttaaacttgaagctggctcatgtcttgaacatggtcacaggc
accattcacacctaccctgtgactgaggacgagagtctgcaaagcctgaaggccaggatc
caggaggacacgggcatcgccgaggaggaccaggagctgctgcaggaggcggggctggcc
ctgatccccgacaagcctgccgctcagtgcatctcagacggcaagctgaacgagggccgc
accctggacatggatctggtcttcctcttcgacaacagcagagtcacctacgagacccag
gtctcgccacggccccagcctgagagcgtcagctgcatcctccaagagcccaagaggaac
ctccccttcttccagctgcggagggtgtggggccaggtgtggcacagcatccaggccctg
aaggaggactgcagccgcctgcagcaggggcagcgagccgccatgatgaatctgctccgg
aacaacagctgcctgtccaagatgaagaactccatggcctccatgtcgcagcagctcaag
gccaagctggacttcttcaagaccagcatccagatcgacctggagaagtacaacgagcag
acggagttcggcatcacgtcagacaaactgcagctggcctggagggagatggagcaggcc
gtggagctctgcggacgggagaatgaggtgaagcacctggtggagcggatgatggcgctg
cagaccgacatcgtggacctgcagcgcagccccatgggccgcaagcagggcgggacgctg
gatgacctagaagagcaagcgagggagctttacaggaggctgagggagaaacccagagac
cagcggactgatggtgacagtcaggaaatggtccggctgctccttcaggccatccagggc
tttgagaagaaagtgcgagtgatttacacgcagctcagcaaaacggtggtttgcaagcag
aaggccctggagttgctgcccaaggtggaggaggtggttagtctaatgaacgaagacgag
aagatggtggttcggcttcaggagaagcggcagaaggagctctggaacctcctgaagatc
gcgtgtagcaaggtccgtggtcctgtcagcggaagcccagacagcatgaacgcttctcgc
ctgagtcaccccggccagctgatgtcacagccctgcactgcccccgacagcgaggccgtc
aagaaaagcgaggagctggtggccgaagcgcacactctctgcacccagctagaaaatgca
ctgcaagacaccatgaaggagcaggaccagagcttaaggtctctagactggagctggtta
cagacggcggaggaggagcagaacggcctggagcaggcctcgtga

KEGG   Camelus ferus (Wild Bactrian camel): 102519782
Entry
102519782         CDS       T02979                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01523  Antifolate resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04062  Chemokine signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04380  Osteoclast differentiation
cfr04620  Toll-like receptor signaling pathway
cfr04621  NOD-like receptor signaling pathway
cfr04622  RIG-I-like receptor signaling pathway
cfr04623  Cytosolic DNA-sensing pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04657  IL-17 signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04668  TNF signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr05132  Salmonella infection
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05212  Pancreatic cancer
cfr05215  Prostate cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05340  Primary immunodeficiency
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102519782 (IKBKG)
   04014 Ras signaling pathway
    102519782 (IKBKG)
   04064 NF-kappa B signaling pathway
    102519782 (IKBKG)
   04668 TNF signaling pathway
    102519782 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102519782 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102519782 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102519782 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102519782 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102519782 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102519782 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102519782 (IKBKG)
   04660 T cell receptor signaling pathway
    102519782 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102519782 (IKBKG)
   04659 Th17 cell differentiation
    102519782 (IKBKG)
   04657 IL-17 signaling pathway
    102519782 (IKBKG)
   04662 B cell receptor signaling pathway
    102519782 (IKBKG)
   04062 Chemokine signaling pathway
    102519782 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102519782 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102519782 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102519782 (IKBKG)
   05203 Viral carcinogenesis
    102519782 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102519782 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102519782 (IKBKG)
   05221 Acute myeloid leukemia
    102519782 (IKBKG)
   05220 Chronic myeloid leukemia
    102519782 (IKBKG)
   05215 Prostate cancer
    102519782 (IKBKG)
   05222 Small cell lung cancer
    102519782 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102519782 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102519782 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102519782 (IKBKG)
   05135 Yersinia infection
    102519782 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102519782 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102519782 (IKBKG)
   05161 Hepatitis B
    102519782 (IKBKG)
   05160 Hepatitis C
    102519782 (IKBKG)
   05171 Coronavirus disease - COVID-19
    102519782 (IKBKG)
   05164 Influenza A
    102519782 (IKBKG)
   05162 Measles
    102519782 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102519782 (IKBKG)
   05163 Human cytomegalovirus infection
    102519782 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102519782 (IKBKG)
   05169 Epstein-Barr virus infection
    102519782 (IKBKG)
   05165 Human papillomavirus infection
    102519782 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102519782 (IKBKG)
   05142 Chagas disease
    102519782 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102519782 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102519782 (IKBKG)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102519782 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1
Other DBs
NCBI-GeneID: 102519782
NCBI-ProteinID: XP_032331088
LinkDB
Position
X
AA seq 419 aa
MSRPPWKSQPSEMVQPSSGPAGDPDVLAEESSLGKPAMLHLPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRLQGSQREEKEFLMQKFQEARKLVERLSLEKVDLRRQKEQ
ALHEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAAKERQALESRARAASEQ
ARQLESEREALQQRHSVQVDQLRMQNQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSGAVSSERSRGSQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMRKRH
VEVSQAPLAPASTHHSFQLALPSQRRSPPEEPLNFCCPKCQYQAPDIDTLQIHVMECID
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggccgccctggaagagtcagccgagtgagatggtgcagcctagcagcggccca
gcaggggacccagacgtgctggctgaagagtcttctctggggaagccggccatgctccac
ctgccttcagagcagggcaccccggagaccttccagcgctgtctggaggagaatcaagag
ctccgagatgctatcaggcagagcaaccagatgctgcgggagcgctgtgaggagctgcag
cgtctgcagggcagccagcgggaggagaaggaattcctcatgcagaagttccaggaggcc
aggaagctggtggagagactgagcctggagaaggtggacctgcgccggcagaaggagcag
gccctgcatgaggtggagcacctgaagcggtgccagcagcagatggccgaggacaaggcc
tcagtgaaggcgcaggtgacgtccctgctgggggagctccaggagagccagagtcgcctg
gaggccgccgccaaggagcggcaggctctggagagcagggcccgggcagccagcgagcag
gcccggcaactggagagtgagcgggaggcgctgcagcagcggcacagcgtgcaggtggac
cagctgcgcatgcagaaccagagcatggaggccgccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctgcaggtggcctatcaccagctcttccaggag
tacgacagccacatcaagagcggcgcggtgagcagcgagcggagcagaggatcgcagctg
gaagatctcaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaattg
atcgacaaactgaaggaagaggctgagcagcacaagatcgtgatggagacggttccagtc
ctgaaagcccaggcggatatctacaaggcggacttccaggctgagaggcaggcccgggag
aagctggctgagaagaaggagttcctgcaggagcagctggagcagctgcagagggagtac
agcaggttaaagaccagctgccaggaatcggccaggattgaagacatgaggaagcgacac
gtagaggtctcccaggcccccttagcccctgcctcgactcaccactcctttcaactggcc
ctgcccagccagaggagaagcccccctgaggagccactcaacttctgttgccccaagtgc
cagtatcaggcccctgacatagacaccctgcagatacacgtcatggagtgcatcgactag

DBGET integrated database retrieval system