KEGG   Camelus ferus (Wild Bactrian camel): 102503564Help
Entry
102503564         CDS       T02979                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04371  Apelin signaling pathway
cfr05034  Alcoholism
cfr05165  Human papillomavirus infection
cfr05169  Epstein-Barr virus infection
cfr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102503564 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    102503564 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    102503564 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    102503564 (HDAC4)
   05165 Human papillomavirus infection
    102503564 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfr03036]
    102503564 (HDAC4)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102503564 (HDAC4)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102503564 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 102503564
NCBI-ProteinID: XP_014408817
LinkDB All DBs
Position
Un
AA seq 1008 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVASALPLPVAPPAVPMDLRLDHQFPLP
VAEPALREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRSLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGVSASCNHPVLGLYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAP
SSPNNSSGNVSTENGIAPAVPSIPTEASLAHRLVTREGSVGPLPLYTSPSLPNITLGLPA
TGPSAVRGGSGSQQEAERLALPALQQRLSLFPGTHLAPYLSTAPLERDAGAAHSSLLQHM
VLLEQPPAQTPLVTGPHGAHSGSRIHSISCPSQVPDGTRQMLGCVPPQHHGQRLAPTRRG
GVEGALAQDERVPGSSPSRASREETEEELREHQALLEEPFLDRLSGQKEALALAGVQVKQ
EPLESDDEEVEPRPGSDHMGSSGSPPMVGGPAAWTPAHPSDCHPPLPPAPGLVYDTLMLK
HQCACGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHALLYG
TNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFK
VATGELKNGFAVVRPPGHHAEENTPMGFCYFNSVAIAAKLLQQRLNVTKTLVVDWDVHHG
NGTQQAFYSDPSVLYISLHRYDDGNFFPGSGAPDEVGAGPGVGFNVNMAFTGGLDPPMGD
AEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLA
GGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVIEIH
SQYWRSLQRPSSTAGYSLVEAQKCETEEAETVTAMASLSVGVKAAEKR
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagacggactttctggccgggaccagccagtggagctgctg
aaccctgcccgcgtgaaccacatgcccagcacggtggatgtggcctcggctctgcctttg
ccggtggcccccccggcggtgcccatggacctgcgcctggaccaccagttcccgctgccc
gtggcggagcctgcgctccgggagcagcagctgcagcaggagctcctggccctgaagcag
aagcagcagctccagaggcagatcctcatcgctgagttccagaggcagcacgagcagctg
tcccggcagcacgaggcccagctccacgagcacatcaaacaacagcaggagctgctggcc
atgaagcaccagcaggagctgctggagcatcagcggaagctggagcgacaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaaa
ggaaaagagagtgcggtggcgagcacggaagtgaagatgaagctgcaggagtttgtcctc
aacaagaagaaggcgctggcccaccggagcctgaaccactgcatgtccagcgaccctcgc
tactggtacgggaagacgcagcacagctccctggaccagagctccccgccgcagagcggg
gtgtcggcctcctgcaaccacccagtcctgggcctgtacgacgccaaggacgactttcct
ctcagaaagacagcttctgagccaaatctgaaattacgctccaggctaaagcagaaagtg
gctgaaagacggagcagccccctgttacgcaggaaagatgggccggtggttaccgcgctg
aagaagcgtccgctggatgtcactgactccgcgtgcagcagtgccccgggctccgccccc
agctcgcccaacaacagctccgggaacgtcagcacggagaatgggatcgcgcccgccgtc
cccagcatcccgaccgaggccagcttggcgcacagactggtgacccgggaaggctccgtg
ggcccgctgcccctctacacgtcaccctccttgcccaacatcacgctgggacttcctgcc
accggcccatctgctgtaaggggcggcagcggcagccagcaggaagccgagaggctggcc
ctcccagccctccagcagcgcctctctctgtttcccggcacccacctcgccccctacctg
agcacggcgcccctggagcgggacgcgggggcggcgcacagctccctcctgcagcacatg
gtcctcctggagcagccgcccgcacagacgcccctcgtcacaggtccacatggtgctcac
agcggctcccgcatccacagtattagctgccccagccaggtgcctgatggcacgcgccaa
atgctgggctgtgtgccccctcagcaccacggacagcgcctggcacccacgcggcgtggg
ggagtagaaggggccttggcgcaggatgagcgcgtccctggatcatccccaagccgagcg
agccgggaggagacggaggaggagctgcgggaacaccaggccctcctggaggagcccttc
ctggaccggctctcagggcagaaggaggcgctcgcgctggccggggtgcaggtgaagcag
gagcccctcgagagtgacgacgaggaggtggagccccgtccaggctcagaccacatgggg
agcagcggctcacctcccatggtgggtgggccagcagcctggacccctgcccacccgtct
gactgccacccgcctctgccccccgcgccaggcctggtgtacgacacgctgatgctgaag
caccagtgcgcctgcggcaacaccaacagccacccggagcatgccgggaggatccagagc
atctggtcccggctgcaggagaccggcctgcgcggcaagtgcgagtgcatccgtggtcgg
aaggccaccctggaggagctgcagacggtgcattcggaggcgcatgccctgctctacggc
acgaaccccctcaacaggcagaaactggacagtaagaaacttctaggctccctaacgtcg
gtgtttgtcaggcttccctgtggtggtgtcggggtggacagtgacaccatttggaacgag
gtgcactcatcgggggcggcccgcctggccgtgggctgcgtggtggagctggtcttcaag
gtggccacgggggagctgaagaacggctttgctgtggtccgcccccccggccaccacgca
gaggagaacacacccatggggttctgctacttcaactccgtggccatcgcagccaagctc
ctccagcaaaggctgaatgtgaccaagaccctcgtcgtggactgggatgtacaccacggg
aacgggacccagcaggccttctacagcgaccccagcgtcctgtacatctccctgcaccgc
tacgatgatggaaacttcttcccgggcagcggggcgcctgacgaggtgggcgcaggcccg
ggcgtgggcttcaacgtcaacatggctttcaccggcggccttgacccccccatgggagac
gcagagtatctggcggccttcagaactgtggtcatgcccatcgccaacgagtttgccccg
gacgtggtgctggtgtcgtcgggcttcgatgccgtggagggccaccccacacccctcggc
ggctacaacctctctgccaagtgtttcgggtacctgacgaagcagctgatgggcctggct
ggcggccgggttgtgctggccctggaggggggccacgacctcacagccatttgcgacgcc
tcggaagcgtgcgtgtccgcgctgctggggaacgagcttgatcctctcccagagaaagtt
ctacagcagagacccaatgcgaacgctgtccggtctatggagaaagtcatcgaaatccac
agccagtactggcgctccctgcagcgcccttcctccaccgcggggtactctctggtcgag
gcccagaagtgcgagacggaggaagcggagactgtcacggccatggcctcgctgtccgtg
ggcgtgaaggcggcggagaagaggtga

DBGET integrated database retrieval system