KEGG   Camelus ferus (Wild Bactrian camel): 102504100
Entry
102504100         CDS       T02979                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04110  Cell cycle
cfr04213  Longevity regulating pathway - multiple species
cfr04330  Notch signaling pathway
cfr04613  Neutrophil extracellular trap formation
cfr04919  Thyroid hormone signaling pathway
cfr05016  Huntington disease
cfr05031  Amphetamine addiction
cfr05034  Alcoholism
cfr05165  Human papillomavirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05203  Viral carcinogenesis
cfr05206  MicroRNAs in cancer
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102504100 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102504100 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102504100 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102504100 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102504100 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102504100 (HDAC2)
   05202 Transcriptional misregulation in cancer
    102504100 (HDAC2)
   05206 MicroRNAs in cancer
    102504100 (HDAC2)
   05203 Viral carcinogenesis
    102504100 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102504100 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102504100 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    102504100 (HDAC2)
   05034 Alcoholism
    102504100 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102504100 (HDAC2)
   05165 Human papillomavirus infection
    102504100 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfr03036]
    102504100 (HDAC2)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102504100 (HDAC2)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102504100 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     102504100 (HDAC2)
    BRAF-HDAC complex
     102504100 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102504100 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    102504100 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 102504100
NCBI-ProteinID: XP_032340624
LinkDB
Position
8
AA seq 488 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaagaagaaagtctgctactactacgatggtgatatt
ggaaattattattatggacagggtcatcccatgaaacctcatagaatccgcatgacccat
aacttgctgctaaattatggcttatatagaaagatggaaatatataggccccataaagct
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctacgttcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaggat
tgtccagtgtttgatggactctttgaattttgtcaactttcaactggtggctcagttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatatagtgcttgcc
atccttgaattactaaaatatcatcagagagtcttatatattgacattgatatccatcat
ggtgatggcgttgaagaagctttttatacaacagatcgtgtaatgactgtatcattccat
aaatatggggaatactttcctggaacaggagacttgagggatattggtgctggaaagggc
aaatactatgctgtcaattttccaatgagagatggaatagatgatgaatcatatgggcag
atatttaagcctattatctcaaaagtgatggagatgtatcaacctagtgctgtggtgtta
cagtgtggtgcagactcactgtctggcgatagacttggttgcttcaatctgacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccattactgatgcttggg
ggaggcggatacacaatccgtaatgttgctcgatgttggacatatgagactgcagttgcc
cttgattgtgagattcccaatgaattgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaatatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttacctcatgcacctggcgtc
caaatgcaagctattccagaggatgcagttcatgaagacagtggtgatgaagatggagaa
gatccagacaagagaatttctattcgagcgtcagacaaacggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaggctagaatcgaagaagacaagaaggaaacggaggacaaaaaagcagat
gttaaggaagaagataaatccaaggacaatagtggtgaaaaaacagataccaaaggagcc
aaatcagaacagctcagcaacccttga

KEGG   Camelus ferus (Wild Bactrian camel): 102508320
Entry
102508320         CDS       T02979                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04110  Cell cycle
cfr04213  Longevity regulating pathway - multiple species
cfr04330  Notch signaling pathway
cfr04613  Neutrophil extracellular trap formation
cfr04919  Thyroid hormone signaling pathway
cfr05016  Huntington disease
cfr05031  Amphetamine addiction
cfr05034  Alcoholism
cfr05165  Human papillomavirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05203  Viral carcinogenesis
cfr05206  MicroRNAs in cancer
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102508320 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102508320 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102508320 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102508320 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102508320 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102508320 (HDAC1)
   05202 Transcriptional misregulation in cancer
    102508320 (HDAC1)
   05206 MicroRNAs in cancer
    102508320 (HDAC1)
   05203 Viral carcinogenesis
    102508320 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102508320 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102508320 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    102508320 (HDAC1)
   05034 Alcoholism
    102508320 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102508320 (HDAC1)
   05165 Human papillomavirus infection
    102508320 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfr03036]
    102508320 (HDAC1)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102508320 (HDAC1)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102508320 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     102508320 (HDAC1)
    BRAF-HDAC complex
     102508320 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102508320 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    102508320 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 102508320
NCBI-ProteinID: XP_032351696
LinkDB
Position
13
AA seq 482 aa
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVAEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaggaggaaagtctgttactactacgatggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctgcttaattatggtctctaccgaaaaatggaaatctatcgcccccacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcttgcgctccatccgc
ccagataacatgtctgaatacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtatttgatggcctgtttgagttctgtcagctgtctactggtggctctgtggcaagt
gccgtgaagcttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaagcatctggtttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcatcagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgagtcatgactgtgtcctttcataaa
tatggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tattatgctgttaactacccgctccgagatgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcccagtgcggtcgtcttacag
tgtggctccgactccctgtctggggatcggttaggttgcttcaatttgaccatcaaaggg
cacgccaagtgtgtggaatttgtgaagagcttcaacctgcctatgctgatgctgggagga
ggtggctacaccattcgtaatgttgcacggtgctggacatacgaaacagctgtggccctg
gacacagagatcccaaatgagcttccatacaacgactacttcgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaatacaaatgagtatctggaa
aagatcaaacagcgactgtttgagaacctgagaatgctgccccacgcacctggggtccaa
atgcaggccattcccgaggatgccattccggaggagagtggagacgaggatgaagaagac
cctgacaagcgcatctcgatctgctcctcggacaaacgaattgcctgtgaggaggagttc
tctgactctgatgaggagggagaaggtggtcgcaaaaactcttccaactttaaaaaggcc
aagagagtcaaaacagaagatgagaaagagaaagacccagaagagaaaaaagaagtcgca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ctggcctga

DBGET integrated database retrieval system