KEGG   Camelus ferus (Wild Bactrian camel): 102504124
Entry
102504124         CDS       T02979                                 

Gene name
CBL
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04012  ErbB signaling pathway
cfr04120  Ubiquitin mediated proteolysis
cfr04144  Endocytosis
cfr04910  Insulin signaling pathway
cfr05100  Bacterial invasion of epithelial cells
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102504124 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102504124 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102504124 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102504124 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102504124 (CBL)
   05205 Proteoglycans in cancer
    102504124 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102504124 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102504124 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102504124 (CBL)
   04121 Ubiquitin system [BR:cfr04121]
    102504124 (CBL)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102504124 (CBL)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102504124 (CBL)
Ubiquitin system [BR:cfr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    102504124 (CBL)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4
Other DBs
NCBI-GeneID: 102504124
NCBI-ProteinID: XP_032328482
LinkDB
Position
33
AA seq 910 aa
MAGNVKKSSGAGGGGGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMESLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPGGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLQQRVSIPSSVSGLGTASKAPSGSLHKDKPLPIPPTLR
DLPPPPPPDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSGRVGEISWLPRPVPKVP
VVAPNPSDPWTGRELTNRHSLPFSLPSQMEPRADVPRLGSTFSLDTSTNMNSSPLAGPES
EHPKIKPSASANAIYSLAARPLPVPKLPPGEQCENEEDTEYMTPSSRPVGLQKPEVKWPL
ETTQSAWACDCDQQVDSCTYEAMYNIQSQAVPSTTESGTFGEGNLAAAHANTGPEESENE
DDGYDVPRPPLPAVLARRTLSDISNASSSFGWLSLEGDPTTNFTEGSQVPERPPKPFPRR
INSERKASSCQQSSAAASPQLSSEIESLLSQGYSYQDIQKALVIAHNNIEMAKNILREFV
SISSPAHVAT
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggccggcaatgtgaaaaagagctccggggccgggggaggcggcggctccggcggctcg
ggctcgggcggcctgatcgggctcatgaaggacgccttccagccgcaccaccaccaccac
caccacctcagcccccacccgccggggaccgtggacaagaagatggtggagaagtgctgg
aagctcatggacaaggtggtgcgtttgtgtcagaacccaaagctggcgctaaagaatagc
ccaccttatatcttagacctgctgccagatacctaccagcatctccgcactatcttgtca
agatatgaggggaagatggagtcacttggagaaaatgagtattttagggtgttcatggaa
aatttgatgaagaaaactaagcagaccataagcctcttcaaggagggaaaagaaagaatg
tatgaggagaattctcagcctaggcgaaacctaaccaaactgtccctgatcttcagccac
atgctggcagagctaaaaggaatctttccaggtggactctttcaaggagacacgtttcgg
attactaaagctgatgctgcagaattttggagaaaagcttttggggaaaagacaatagtc
ccttggaagagcttcagacaggcccttcatgaagtgcatcccatcagttctgggctggaa
gccatggctctgaaatccactattgatctgacctgcaatgattatatttcagtttttgaa
ttcgacatctttacacggctctttcagccctggtcatctttgctcaggaactggaacagt
cttgctgtaactcatcctggttacatggctttcctgacatatgatgaagtgaaagctcgg
ctccagaaattcattcacaaacctggcagttacattttccggctgagctgtactcgtctg
ggtcagtgggctattggttacgtcactgctgatgggaacattctccagacaatccctcac
aataaacctcttttccaagcactgattgatggcttcagggaaggcttctatttgtttcct
gatggacgaaatcagaatcctgacctgacaggcttatgtgaaccaactccccaagaccac
atcaaagtgacccaggaacaatatgaattatactgtgagatgggctccacattccaactg
tgtaaaatatgtgctgaaaatgataaagatgtaaagatcgagccctgcggacacctcatg
tgcacatcctgtctgacatcctggcaggaatcagaaggccagggctgtcctttctgccga
tgtgaaattaaaggtactgagcccattgtggttgatccctttgatcctagaggaagtggc
agcctgttgaggcaaggagcagagggagctccctccccaaattatgacgatgatgacgat
gaacgagctgatgattctctcttcatgatgaaggagttggccggcgccaaggtggaacgg
cctccttctccattctccatggccccacaagcttcccttcccccagtgccaccccggctt
gaccttctacaacagcgagtatctattccttcgagtgtttctggtcttggaactgcttct
aaggctccttctggctccctgcataaggacaaaccattaccaatacctcccactcttcga
gatcttccaccaccaccccctccagaccggccatattctgttggagcagaaacccggcct
cagagacgccccttgccttgtacaccaggcgactgtccttccagagacaaactgccccct
gtcccctctggccgcgttggagaaatatcatggctacctcggccagtccccaaagtacca
gtagttgccccaaaccctagtgacccctggacagggagagaattaaccaaccggcactca
cttccattttcattgccctcccaaatggaacccagagccgacgtgcccaggctcggaagc
acattcagtctggatacctccacgaatatgaatagcagcccattagcaggtccagagagt
gagcatccgaaaatcaaaccttctgcttctgccaatgccatttattctctggctgccaga
cctcttcctgtgccaaagctgccacctggggagcagtgtgaaaatgaggaagacacagag
tatatgactccctcctctaggcctgtgggacttcaaaagccagaggtgaaatggcctttg
gagacaacccagagtgcatgggcatgtgattgtgaccagcaggttgatagctgtacatac
gaagcgatgtataatatccagtcccaggcggtgccatctaccacagagagcggcaccttt
ggtgaagggaatttggctgcagcccatgccaacactggccctgaggaatcagaaaacgaa
gacgatggatatgacgtccccaggccacccttgcccgcggtgctggcccgccgcacactc
tcagacatctccaacgccagctcctccttcggctggctgtctctggaaggtgatcccaca
acaaacttcactgagggttcccaagttcctgagaggcctcccaaaccgttccctcggaga
atcaactctgaacgaaaagcaagtagctgtcagcagagcagcgccgccgcctccccgcag
ctctccagtgagatcgagagccttctgagtcagggatactcctaccaggacattcagaaa
gccctggtcattgcccacaacaacatcgaaatggccaaaaatatcctccgggaatttgtt
tccatttcttctcctgcccacgtagccacctag

DBGET integrated database retrieval system