KEGG   Camelus ferus (Wild Bactrian camel): 102504272
Entry
102504272         CDS       T02979                                 

Gene name
EGFR
Definition
(RefSeq) LOW QUALITY PROTEIN: epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04020  Calcium signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04144  Endocytosis
cfr04151  PI3K-Akt signaling pathway
cfr04510  Focal adhesion
cfr04520  Adherens junction
cfr04540  Gap junction
cfr04630  JAK-STAT signaling pathway
cfr04810  Regulation of actin cytoskeleton
cfr04912  GnRH signaling pathway
cfr04915  Estrogen signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr04934  Cushing syndrome
cfr05160  Hepatitis C
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102504272 (EGFR)
   04012 ErbB signaling pathway
    102504272 (EGFR)
   04014 Ras signaling pathway
    102504272 (EGFR)
   04015 Rap1 signaling pathway
    102504272 (EGFR)
   04630 JAK-STAT signaling pathway
    102504272 (EGFR)
   04066 HIF-1 signaling pathway
    102504272 (EGFR)
   04068 FoxO signaling pathway
    102504272 (EGFR)
   04020 Calcium signaling pathway
    102504272 (EGFR)
   04072 Phospholipase D signaling pathway
    102504272 (EGFR)
   04151 PI3K-Akt signaling pathway
    102504272 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102504272 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102504272 (EGFR)
   04520 Adherens junction
    102504272 (EGFR)
   04540 Gap junction
    102504272 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102504272 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102504272 (EGFR)
   04915 Estrogen signaling pathway
    102504272 (EGFR)
   04921 Oxytocin signaling pathway
    102504272 (EGFR)
   04926 Relaxin signaling pathway
    102504272 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    102504272 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102504272 (EGFR)
   05206 MicroRNAs in cancer
    102504272 (EGFR)
   05205 Proteoglycans in cancer
    102504272 (EGFR)
   05230 Central carbon metabolism in cancer
    102504272 (EGFR)
   05231 Choline metabolism in cancer
    102504272 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102504272 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102504272 (EGFR)
   05212 Pancreatic cancer
    102504272 (EGFR)
   05225 Hepatocellular carcinoma
    102504272 (EGFR)
   05226 Gastric cancer
    102504272 (EGFR)
   05214 Glioma
    102504272 (EGFR)
   05218 Melanoma
    102504272 (EGFR)
   05219 Bladder cancer
    102504272 (EGFR)
   05215 Prostate cancer
    102504272 (EGFR)
   05213 Endometrial cancer
    102504272 (EGFR)
   05224 Breast cancer
    102504272 (EGFR)
   05223 Non-small cell lung cancer
    102504272 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102504272 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102504272 (EGFR)
   05171 Coronavirus disease - COVID-19
    102504272 (EGFR)
   05163 Human cytomegalovirus infection
    102504272 (EGFR)
   05165 Human papillomavirus infection
    102504272 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102504272 (EGFR)
   01522 Endocrine resistance
    102504272 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102504272 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102504272 (EGFR)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102504272 (EGFR)
Protein kinases [BR:cfr01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102504272 (EGFR)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102504272 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   102504272 (EGFR)
  Exosomal proteins of bladder cancer cells
   102504272 (EGFR)
SSDB
Motif
Pfam: Recep_L_domain GF_recep_IV Furin-like PK_Tyr_Ser-Thr Pkinase Borrelia_P83
Other DBs
NCBI-GeneID: 102504272
NCBI-ProteinID: XP_032332259
LinkDB
Position
Unknown
AA seq 846 aa
MRRSGAGRAALLALLAAHFQASPALEEKKVCQGTSNKLTQLGTFEDHFVSLQRMFNNCEV
VLGNLEITYMQNSYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPMRNLQEILQGAVRFSNNPSLCSVETVQWRDIVNNEFLSNMSMDF
QNQPGGCPKCDPSCVNGTCWGAGKENCQKLTKVICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPNGKYSFGATCVKNCPRNYV
VTDHGSCVRACSSDSYEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFRGDSFTRTPPLDPKELDILKTVREITGFLLIQAWPENRTGLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNQNLCYANTINWKKL
FGTSSQKTKIINNRSEQECKAVGHVCNPLCSSEGCWGADPKDCVSCRNVSRGKECVEKCN
VLEGEPREFVENSECVQCHPECLPQAMNVTCTGRGPSSCVKCAHYIDGPNCVKTCPAGIA
GENGTLVWKFADASHVCHLCHPNCTYGCAGPGLKGCAENRPKIPSIATGIVGGLLMVVVL
ALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKVSRRGARQVRPRSRTRL
LGWRYH
NT seq 2541 nt   +upstreamnt  +downstreamnt
atgcggcgctccggggcgggccgcgccgcgctactggcgctgctggccgcgcacttccag
gcgagtccggcgctggaggagaagaaagtttgccaaggcaccagtaacaagctcacccag
ttgggcacgttcgaagaccactttgtgagtctgcagaggatgtttaataactgcgaggtg
gtcctagggaacttggaaatcacctacatgcagaatagttacgacctgtctttcctcaag
accatccaggaggtggccggctatgtactcattgccctcaacaccgtggagaagattcct
ctggaaaacctgcagatcatcaggggcaacgtgctctatgaaaacacccatgccttggcg
gtcctgtccaactacggggcgaataaaaccggactgcgggagctgcccatgagaaacctg
caggagatcctgcaaggtgccgtgcgcttcagcaacaaccccagcttgtgcagcgtggag
actgtccagtggagagacatcgtcaacaacgaattcctcagcaatatgtcgatggacttt
cagaaccagccgggcggttgcccaaagtgtgatccaagctgtgtcaacggaacctgctgg
ggcgcagggaaagagaactgccagaaattgaccaaagtcatctgtgcccagcagtgctcc
gggcgctgccgcgggaggtcccccagtgactgctgtcacaaccagtgtgccgccggctgc
acagggccgcgggagagcgactgcctggtctgccgcaagttccgggacgaagccacgtgc
aaggacacgtgcccgccgctcatgctctacaaccccaccacctaccagatggacgtcaac
cccaacgggaagtacagcttcggggccacctgtgtgaagaactgtccccgtaactacgtg
gtgacagaccacggctcgtgcgtccgcgcctgcagctccgacagctacgaggtggaggag
gacggcgtccgcaagtgtaaaaagtgcgacgggccttgtggcaaagtttgtaacggaata
ggaattggtgagtttaaagacacactctctataaatgccaccaacattaagcacttcaga
aactgcacctcgatcagcggggacctccacatcctgccggtggcattcaggggcgactcc
ttcacacgtactccgcctctggacccaaaggaactggatattctgaaaaccgtaagggaa
ataacagggtttttgctcatccaggcttggccagaaaacaggaccggcctgcacgctttc
gagaacctggaaatcatccgtggcaggacgaagcaacatggtcagttttctctggcggtt
gtcggcctggacataacatctttagggctgcgttccctcaaggagataagtgacggcgac
gtgatcatttcaggaaaccagaacttgtgctatgcaaacacgataaactggaagaaacta
tttgggacttcgagtcagaaaaccaaaattataaacaacaggagtgaacaagagtgcaag
gccgtgggccacgtctgtaacccgctgtgctcatcggagggctgctggggtgcagacccc
aaagactgcgtgtcctgcaggaacgtcagccgtggcaaggaatgtgtggagaaatgcaac
gttctggagggagagcccagggaattcgtggagaactcagagtgtgtgcagtgccacccg
gagtgcctgccccaggccatgaacgtcacctgcacgggacgcggaccgagcagctgtgta
aagtgtgcccactacatcgatggccctaactgcgtgaagacctgccccgccggcatcgcg
ggcgagaatggcaccctggtctggaagtttgcggatgccagtcacgtgtgtcacctttgc
caccccaactgcacctatggctgtgccgggccaggtctcaaaggctgtgcagagaacagg
cccaagattccgtccatcgccaccgggatcgtggggggcctcctgatggtcgtggtgctg
gccctgggggtcggcctcttcctgcgcagacgccacattgtccgcaagcgcacgctgcgc
cggctgctgcaggagcgcgagctggtcgagcctctgacacccagcggagaagcgcccaac
caagctctcttgaggatcctgaaggaaacagaattcaaaaaggtcaaggtgctgggctcc
ggagcattcggcacagtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
ccagtcgcgatcaaggagttgagagaagccacgtctccgaaagccaacaaggaaatcctg
gacgaagcctacgtgatggccagtgtggacaaccctcacgtgtgccgcctgctgggcatc
tgcctcacctccacggtgcagctcatcacgcagctcatgcccttcggctgcctcctggac
tacgtccgcgagcacaaggacaacatcgggtcccagcatttgctcaactggtgcgtgcag
atcgcgaaggtgagtcggaggggcgcgcggcaggtacggcctcgaagcaggactcgtctc
ctggggtggcgctatcattag

DBGET integrated database retrieval system