KEGG   Camelus ferus (Wild Bactrian camel): 102504617
Entry
102504617         CDS       T02979                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01524  Platinum drug resistance
cfr03320  PPAR signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04210  Apoptosis
cfr04510  Focal adhesion
cfr04660  T cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr04910  Insulin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04931  Insulin resistance
cfr04960  Aldosterone-regulated sodium reabsorption
cfr05145  Toxoplasmosis
cfr05205  Proteoglycans in cancer
cfr05213  Endometrial cancer
cfr05215  Prostate cancer
cfr05223  Non-small cell lung cancer
cfr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102504617 (PDPK1)
   04071 Sphingolipid signaling pathway
    102504617 (PDPK1)
   04151 PI3K-Akt signaling pathway
    102504617 (PDPK1)
   04152 AMPK signaling pathway
    102504617 (PDPK1)
   04150 mTOR signaling pathway
    102504617 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102504617 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    102504617 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102504617 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102504617 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    102504617 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102504617 (PDPK1)
   03320 PPAR signaling pathway
    102504617 (PDPK1)
   04919 Thyroid hormone signaling pathway
    102504617 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102504617 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102504617 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102504617 (PDPK1)
   05231 Choline metabolism in cancer
    102504617 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102504617 (PDPK1)
   05213 Endometrial cancer
    102504617 (PDPK1)
   05223 Non-small cell lung cancer
    102504617 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102504617 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102504617 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102504617 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102504617 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102504617 (PDPK1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102504617 (PDPK1)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   102504617 (PDPK1)
Membrane trafficking [BR:cfr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    102504617 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 102504617
NCBI-ProteinID: XP_032316115
LinkDB
Position
18
AA seq 593 aa
MIMEVCKMNFHTVMLLQCKYIPPTGGAVGIGKSGNGLAQFDTKYDTVPIQSSVVLCSCPS
PSMVRTQTESSTAPGVPSGGSRQGPTMDSTAAESRPSANTLQHTTQPPPQPRKKRPEDFK
FGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFV
KLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEMVSALEYLHGKGIIH
RDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSS
DLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATK
RLGCEEMEGYSPLKAHPFFESITWENLHHQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQF
GCMQVSSSSSSHSLSAADAGLPQRAGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQA
SGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQE
LRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWRHRYQSHPDAAVQ
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgatcatggaagtttgtaaaatgaactttcacacagtgatgctgttgcaatgcaagtat
ataccaccaacagggggagcggtaggaattgggaagtctggaaatggcctggctcagttt
gatactaagtatgacaccgttcctattcagtccagcgtggtgttatgttcctgcccatcc
ccatcaatggtgaggacccagactgagtccagcacggcccctggcgttcccagcggtggt
agcaggcagggccccaccatggacagcaccgcagctgaatcccggcccagtgccaacacg
ctacaacacaccacacaaccgccaccacagcctcggaagaaacggccagaagactttaaa
tttgggaaaattcttggtgaaggctctttttcaacagttgtcctggcccgagaactggca
acctcaagggaatatgccattaaaattctagagaaacgtcacattatcaaagagaacaag
gtcccgtatgtaacccgagagagagacgtgatgtcacggctggatcaccccttctttgtt
aaactttacttcacgtttcaggatgatgaaaagctgtattttggccttagttatgccaaa
aatggagaacttcttaaatacattcgcaaaattggttcattcgatgagacatgcacgcga
ttttacacagccgagatggtgtccgccctagagtacttgcatggcaagggcatcattcac
agggacctgaaaccagagaacattttgttaaatgaagatatgcacatccagattacagat
tttggaacagcaaaagtattatccccagagagtaaacaagccagggccaactcgtttgta
ggaacagcccagtatgtttctccagagctgctcacagagaaatcggcctgtaaaagttca
gacctttgggctcttggatgcattatataccagcttgtggcaggcctaccaccattccga
gccggaaatgaatatctaatatttcagaagatcattaagttggaatatgactttcctgaa
aaattctttcctaaggcaagagaccttgtggaaaaactgctggttttggatgctacaaag
cgattaggctgtgaagaaatggaagggtacagccctctgaaagctcatccgttcttcgag
tccatcacatgggagaatctgcatcaccagacgcctccgaagctcacagcttacttgcca
gccatgtcggaagacgacgaagactgctatggaaactacgacaatctcctgagccagttt
ggctgcatgcaggtgtcctcatcgtcctcctcccactccctgtcagctgcggatgcaggg
ctgccacagagggcaggcagcaacatcgagcagtatatccacgacctggacactaactct
tttgagctggacttacagttttctgaagatgagaagaggttgttattggagaagcaggcc
agtggaaacccttggcaccagtttgtagaaaataatttaatactaaaaatgggtccagta
gataagcgaaagggtttatttgcacggcgacgacagttactgctcacagaagggccacac
ttatattatgtggatcctgtcaacaaagtcttgaaaggtgaaattccatggtcgcaagaa
ctccgaccagaggccaagaattttaaaaccttctttgtccacacgccgaataggacgtat
tacctgatggacccgagtgggaatgctcacaaatggtgcaaaaagatccaggaggtgtgg
aggcacagatatcagagccacccagacgccgctgtgcagtga

DBGET integrated database retrieval system