KEGG   Camelus ferus (Wild Bactrian camel): 102504628
Entry
102504628         CDS       T02979                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2 isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04015  Rap1 signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04080  Neuroactive ligand-receptor interaction
cfr04151  PI3K-Akt signaling pathway
cfr04810  Regulation of actin cytoskeleton
cfr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102504628 (LPAR2)
   04072 Phospholipase D signaling pathway
    102504628 (LPAR2)
   04151 PI3K-Akt signaling pathway
    102504628 (LPAR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102504628 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102504628 (LPAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102504628 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cfr04030]
    102504628 (LPAR2)
G protein-coupled receptors [BR:cfr04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102504628 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 zf-UBR
Other DBs
NCBI-GeneID: 102504628
NCBI-ProteinID: XP_014407522
LinkDB
Position
22
AA seq 356 aa
MREGKMVTMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVTLGLTVSVLVLLTNLLIIA
AIASNRRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSL
TASVATLLAIAVERHRSVMAVQLHSRLPRGRVIMLIVGVWVAALGLGLLPAHSWHCLCAL
DRCSRMAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRET
TLSLVKTVVIILGAFVVCWTPGQVVLLLDGLGCKSCNVLAVEKYFLLLAEANSLVNAVVY
SCRDAEMRRTFRRLLCCLCLRRSTHESAHYTPSTRTGTSTRIMLSENGHPLMDSTL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagggaggggaagatggtcaccatgggccagtgctactacaacgagaccatcggcttt
ttctacaacaacagtggcaaggagctgagctcccactggcggcccaaggatgtggttgtg
gtgacactggggctgactgtcagcgtgctggtgctactgactaacctgctgatcatcgca
gccatcgcctccaaccgccgcttccaccagcccatttactacctgctcggcaacctggcc
gcagctgacctctttgctggtgtagcctacctcttcctcatgttccacacgggcccgcgc
acagcccggctctcactggagggctggttcttgcgacagggcctgttggacacaagccta
acggcatccgtagccacgctgctggccattgccgtggaacggcaccgcagcgtgatggcc
gtgcagctgcacagccgcctgccccgaggccgggtcatcatgctcatcgtgggcgtgtgg
gtggcggcactgggcctggggctgctgcctgcccactcctggcactgcctctgcgccctg
gaccgctgctcacgcatggcccccctactcagccgctcctacctggccgtttgggccctg
tccagcctgctcgtcttcctgctcatggtggccgtctacacccgcattttcttctatgta
agacggcgggttcagcgcatggcagagcatgtcagctgccacccccgctaccgtgaaacc
acgctcagcctggtcaagactgttgtcatcatcctgggggcgtttgtggtctgctggacg
ccgggccaggtggtgctccttctggatggtctgggctgcaagtcctgcaatgtcctggct
gtggagaagtatttcctactcttggctgaggccaactcactggtcaacgccgtggtatac
tcatgccgagatgctgagatgcgccgcaccttccgccgcctcctctgctgtctgtgcctc
cgccgatccacccacgagtctgctcactatacaccctccacccggacaggcaccagcact
cgcatcatgctttccgagaatggccatcccctgatggactccaccctttaa

DBGET integrated database retrieval system