KEGG   Camelus ferus (Wild Bactrian camel): 102504629Help
Entry
102504629         CDS       T02979                                 

Gene name
NANOG
Definition
(RefSeq) Nanog homeobox
  KO
K10164  homeobox protein Nanog
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102504629 (NANOG)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102504629 (NANOG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102504629 (NANOG)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    102504629 (NANOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 102504629
NCBI-ProteinID: XP_006192214
LinkDB All DBs
Position
Un
AA seq 311 aa AA seqDB search
MSADADCPQSLLCPEASNSRETSPMPEPYGPEEDYTSLQMSSAETADTETVSPLPSSMDL
LIQDSPDSSTSPRVKPLPTSAESSTEKQEEKVQVKKQKVRTVFSQTQLCVLNDRFQRQKY
LSLQQMQELSNILNLSYKQVKTWFQNQRMKCKRWQKNNWPRNSSSVTQGSATTEYPGLYS
YHQGCLANTSGNLPMWGNQTWNSPTWNSQTWNSQSWGSHSWNSQPWCPQAWNNQTWNNQA
WNSQFSNCVEEFLQPHIQLQQNSPFSDLEAALESAGESHNVIQQAAKYVSPQQQIMDLFP
SYSMNMQPEDV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgacgccgattgtccccaaagcctgctttgccccgaagcatccaattctagg
gagacttcaccaatgcctgagccttatgggcctgaagaagattacacatccttgcagatg
tcatctgctgagacagccgacacggagactgtctctcctcttccttcctccatggatctg
cttattcaggacagccctgattcttccaccagccccagagtaaaaccactgcccacttct
gcagagagcagcacagagaagcaggaagagaaggtccaggtcaagaaacagaaggtcaga
accgtgttctcccagacccagctgtgtgtgctcaatgacagattccagaggcagaaatac
ctcagcctccagcagatgcaagaactttccaacatcctgaaccttagctacaaacaggtt
aagacctggttccagaaccagagaatgaaatgtaagcggtggcagaagaacaactggcca
aggaacagcagcagcgtgactcagggctcagcaaccacagaatacccgggcctctattct
taccaccaaggatgcctggcgaatacttccggaaaccttcccatgtggggtaaccagacc
tggaatagcccaacttggaacagccagacctggaacagccagtcttggggcagtcactcc
tggaacagtcagccctggtgcccccaagcctggaataaccagacttggaacaaccaggcc
tggaacagtcagttcagcaactgtgtcgaggaattcctgcagccccacatccagctccag
caaaactctcctttcagtgatttggaggccgccttggaaagtgctggggaaagccataat
gtaatacagcaagctgctaagtatgtcagtccccagcagcagatcatggatttattcccc
agttactccatgaacatgcagcctgaagatgtgtga

DBGET integrated database retrieval system