KEGG   Camelus ferus (Wild Bactrian camel): 102504996
Entry
102504996         CDS       T02979                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X2
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01524  Platinum drug resistance
cfr04014  Ras signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04115  p53 signaling pathway
cfr04137  Mitophagy - animal
cfr04140  Autophagy - animal
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04215  Apoptosis - multiple species
cfr04621  NOD-like receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr05012  Parkinson disease
cfr05014  Amyotrophic lateral sclerosis
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05145  Toxoplasmosis
cfr05162  Measles
cfr05166  Human T-cell leukemia virus 1 infection
cfr05168  Herpes simplex virus 1 infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05212  Pancreatic cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102504996 (BCL2L1)
   04630 JAK-STAT signaling pathway
    102504996 (BCL2L1)
   04064 NF-kappa B signaling pathway
    102504996 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    102504996 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102504996 (BCL2L1)
   04137 Mitophagy - animal
    102504996 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    102504996 (BCL2L1)
   04215 Apoptosis - multiple species
    102504996 (BCL2L1)
   04115 p53 signaling pathway
    102504996 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102504996 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102504996 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    102504996 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102504996 (BCL2L1)
   05225 Hepatocellular carcinoma
    102504996 (BCL2L1)
   05220 Chronic myeloid leukemia
    102504996 (BCL2L1)
   05222 Small cell lung cancer
    102504996 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102504996 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    102504996 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    102504996 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102504996 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    102504996 (BCL2L1)
   05162 Measles
    102504996 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    102504996 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102504996 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102504996 (BCL2L1)
   01524 Platinum drug resistance
    102504996 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfr01009]
    102504996 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfr03036]
    102504996 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfr02000]
    102504996 (BCL2L1)
Protein phosphatases and associated proteins [BR:cfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102504996 (BCL2L1)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102504996 (BCL2L1)
Transporters [BR:cfr02000]
 Other transporters
  Pores ion channels [TC:1]
   102504996 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102504996
NCBI-ProteinID: XP_006179292
UniProt: S9YLW4
LinkDB
Position
19
AA seq 233 aa
MSLSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMEIPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctctgagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaagccccagaaggg
actgaatcagagatggaaatccccagtgccatcaatggcaacccatcctggcacctggca
gacagccccgcggtgaatggagccactggccacagcagcagcttggatgcgcgggaggtg
atccccatggcagcggtgaagcaagcgctgagggaggcgggtgatgagtttgaactgagg
taccggcgagcattcagtgacctgacgtcccagctccacatcaccccagggacagcatat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaatgatcacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaacgcagca
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggtgtggttctgctgggctcgcttttcagtcggaaatga

DBGET integrated database retrieval system