KEGG   Camelus ferus (Wild Bactrian camel): 102505386Help
Entry
102505386         CDS       T02979                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04146  Peroxisome
cfr04213  Longevity regulating pathway - multiple species
cfr05014  Amyotrophic lateral sclerosis (ALS)
cfr05016  Huntington disease
cfr05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102505386 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102505386 (SOD1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    102505386 (SOD1)
   05016 Huntington disease
    102505386 (SOD1)
   05020 Prion diseases
    102505386 (SOD1)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102505386 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102505386
NCBI-ProteinID: XP_014417125
LinkDB All DBs
Position
Un
AA seq 124 aa AA seqDB search
MVSGSISGLAEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDQERHVGDLGNVTA
GKDGVAIVSIEDPVISLSGDHSIIGRTMVVHEKPDDLGKGGNEESTKTGNAGSRLACGVI
GIAQ
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggtatcggggtccatttcaggattggccgaaggcgatcatggattccatgtccatcag
tttggagataacacacaaggctgtaccagtgcaggtcctcactttaatcctctgtccaaa
aaacatggtgggccaaaggatcaagagaggcacgttggagacctgggcaatgtgactgct
ggcaaagatggtgtggccattgtgtctattgaagatcctgtgatctcactctcaggagac
cattccatcattggccgcacaatggtggtccatgaaaaaccagatgacttgggcaaaggt
ggaaatgaagaaagtacaaagacgggaaatgctggaagtcgtctggcctgcggcgtgatt
gggatcgcccaataa

DBGET integrated database retrieval system