KEGG   Camelus ferus (Wild Bactrian camel): 102505490Help
Entry
102505490         CDS       T02979                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04614  Renin-angiotensin system
cfr04924  Renin secretion
cfr05142  Chagas disease (American trypanosomiasis)
cfr05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    102505490
   04614 Renin-angiotensin system
    102505490
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    102505490
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    102505490
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102505490
Peptidases [BR:cfr01002]
 Metallo Peptidases
  Family M2
   102505490
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102505490
CD molecules [BR:cfr04090]
 Proteins
  102505490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Alpha-2-MRAP_C DUF1138 Mtc
Motif
Other DBs
NCBI-GeneID: 102505490
NCBI-ProteinID: XP_006177500
LinkDB All DBs
Position
Un
AA seq 759 aa AA seqDB search
MDLPGPCLLVLFCYGQLLPWVRTKGDQDSDKLYNETVAKTFLQFYEHTAQVVWNQFMEAT
WNYVTNITKKNREEMLHKDMERSQHTLYFGTRARLFNIANFQDPDVKRMLSNLQNIGKAA
LPKDKLQEYNQILAYMETTYSMGQVCLNEGPCLSLEPDLEEVMATSRDQKELLWAWQGWR
DAVGRQLRTTFERYVQLSNKAAKLNGYKDMGALWRSTYESNMLEEDLEKLYQELQPLYLN
LHSYVRRALHRFYGPELIDLRGPIPAHVLGNMWAQSWVSILDLVLPFPEKPPEDITKIMK
GQHWKPEKMFQEAEKFFTSLGLLSTPPEFWKNSMMERPTDGREVECHASSWDFYNGKDFR
IKKCTEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFRKGANPAFEEAVGSVVTLSASSHKY
LLNRGLLSHQHQDSEEEVNFLMGIALQKIAFIPFAYLVDLYRWKIFDGTIQKAVYNQEWW
SLRLKYQGLCPPVARSEEDFDPGAKFHISASLPYIRYFISLVLQFQFHEALCKASGHMGP
LHRCDIYNSKEAGKLLEDVLKLGWSKPWPEVLEKITGETKVSAKALMTYFKPLLDWLVTE
NVRHGDILGWPDFSCSFEEKETDRVAFLDLELDPDQAKFGQWMLLALSFVMFLVVLLLAY
RLYTLQKRLLTQDTSAQDTSAQDTSAQDTSAQDTNALKTPPKAYFLGIAMEPHQVAKRQW
MLLGLCLILILCSISLIIRISTQHNRMPPWMRSDWWSWD
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggacttgcctggaccttgcctacttgtgctcttctgttatgggcagctcttgccatgg
gtcaggaccaagggtgatcaggattcagacaagctctacaatgagaccgtggcaaagacc
ttcctgcagttttacgagcatacagcacaggttgtctggaaccagttcatggaagccacc
tggaactatgtcaccaacatcaccaagaaaaatcgagaggagatgctgcacaaggacatg
gagaggtcccagcacacactatactttggcacccgggcccgcctgtttaacattgccaac
tttcaagacccggacgtgaagcgcatgctgagtaacctgcagaacataggcaaggcggcc
ctgcccaaggacaagctccaggagtacaaccagattctggcctacatggagaccacatac
agcatgggccaggtgtgcctgaatgagggaccctgcctgtccctggagcccgacctcgaa
gaagtcatggccacctcccgggaccaaaaggagctgctatgggcctggcagggctggagg
gatgctgtgggtcgccagctccgcaccacctttgagcgctatgtgcagctcagcaacaag
gctgcaaagctcaacggttacaaagacatgggggccttgtggcggtccacatatgagtcc
aacatgctggaggaagacctggagaagctctaccaggagctgcagccgctctacctgaac
ctacactcctacgtgcgccgggccctgcaccgcttctacgggcccgagctcatcgacctg
agggggcccatccctgcccacgtcctggggaatatgtgggctcagtcctgggtcagcatc
ttagacctggtcctccctttcccggagaagccccctgaggacatcacaaagatcatgaaa
ggccagcactggaagcctgagaaaatgttccaagaggctgaaaaattcttcacctccctg
gggctgctttccacccctcctgagttctggaaaaattccatgatggaaaggccaacggac
gggcgggaggtggagtgccacgcgtcctcctgggacttctacaacggcaaggacttcagg
ataaagaagtgcaccgaggtgaccatagaagacctgctctccatcttccaccagatgggc
catatccagtacttcctgcagtacaagaacctctccgtgatcttccgcaaaggtgccaac
ccagcctttgaagaagctgtggggtcagtggtcaccctctcggcctcctcccacaagtac
cttcttaaccgaggactgctcagccaccagcaccaggactcagaggaggaggtcaatttc
ctgatgggcattgccctgcagaagatcgccttcatccccttcgcctacctggtggacctg
tatcgctggaagatctttgatggcaccatccagaaggctgtctacaaccaggagtggtgg
agcctcaggctgaagtaccagggtctgtgcccccctgtcgctcggtcagaggaagacttt
gatccaggcgccaagttccacatctctgccagcctgccctacatacggtacttcatcagc
ctagtgctccagttccagttccacgaagcgctctgcaaggcctcgggccacatgggaccg
ctacaccgctgtgacatctataactccaaggaggctggcaagcttctggaggatgtccta
aagctgggctggagcaagccctggccagaagtcctggagaagataactggggagaccaag
gtgtctgcaaaggccctcatgacctacttcaagcccctgctggactggctggtcactgag
aatgtgcggcatggggatatcttgggctggccagacttcagctgttcctttgaagaaaaa
gagacagacagagtggcattcctggatctggagctggaccctgaccaggccaaatttggg
cagtggatgttactggccctgagctttgtcatgttcctggtggtcctgctgctggcctac
aggctgtacaccctgcaaaaaaggttactgacccaagacaccagtgcacaggacaccagc
gctcaggacaccagcgcacaggacaccagtgcacaggacaccaatgcactcaagacgcca
cccaaagcctacttcctgggcatagccatggagccccaccaggttgccaaaagacagtgg
atgctgctgggactctgcctcatcctgatactgtgctcaatcagcctgatcattcggatt
tccacacagcacaacaggatgcctccgtggatgagatctgactggtggagctgggactag

DBGET integrated database retrieval system