KEGG   Camelus ferus (Wild Bactrian camel): 102505704Help
Entry
102505704         CDS       T02979                                 

Gene name
LIG4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    102505704 (LIG4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cfr03400]
    102505704 (LIG4)
Enzymes [BR:cfr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102505704 (LIG4)
DNA repair and recombination proteins [BR:cfr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     102505704 (LIG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_IV BRCT BRCT_2 RNA_ligase mRNA_cap_enzyme LIG3_BRCT APG17
Motif
Other DBs
NCBI-GeneID: 102505704
NCBI-ProteinID: XP_006195242
LinkDB All DBs
Position
Un
AA seq 911 aa AA seqDB search
MAASQTSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFKEFLDSWRKFHDALHKNQKDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPREGKDALKLLNYRTPTGARA
DAGDFAMIAYFVLKPRCLQKGSLTIQQVNDILDSIASNNSAKRKDLVKKSVLQLITQSSA
LEQKWLIRMIVKDLKLGFSQKTIFSIFHNDAEELHSVTTDLEKVCRQLHDPLVGLSDISI
TLFSAFKPMLAAIADIERIEKDMKHQSFYIETKLDGERMQMHKDGDVYQYFSRNGYNYED
QFGASPQEGSLTPFIHSTFKPDVQNCILDGEMMAYNPHTQTFMQKGNKFDIKRMVEDSDL
QTCYCVFDVLMVNNKKLGHETLRNRHEILNSVFTPIPGRIEIVQKTQAQTKKEVVDALNE
AIDKREEGIMVKHPLSIYKPDKRGEGWLKIKPEYVDELMDKLDILIVGGYWGKGSRGGMM
SHFLCAVAEKPTSGEKPSVFHTLCRVGSGYTMKELYDLGLKLAKHWKPFHKKAPPSSILC
GTEKPEVYIEPCHSVIVQVKAAEIVPSDMYKTGCTLRFPRIEKIREDKEWHECTTLDELE
QLRGQASGKLASKHLHIGGDDEPQEKKRKAAPKVKKVIGIIEHLKAPNLSNISKVSNIFE
DVEFCVMSGTDGHPKPDLENRIAEFGGYIVQNPGPDTYCVIAGAQNIRVKNIISSNKHDV
VKPEWLLECFQTKRCVPWQPRVMIHMCPSTREHFAREYDCYGDSYFVDTDLNQLKEVFSG
IKDPREQTPGEMAAVIADLEHRYSWDSSHLSMFRSHTVYLDLYTVINDLSTKIEGTRLAI
TALELRFHGAKVVSCLAEGVSHVIVGEDRSRVADFKAFRRALKRKFKILQECWVTESIDK
CELQEENQYLV
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcccaaacttcacaaactgttgcctctcacgttccttttgcagatttatgt
tcaactttagaacgaatacagaaaagtaaaggacgggcagaaaaaatcagacacttcaaa
gaatttttagattcttggagaaaatttcacgatgcccttcataagaaccaaaaagatgtc
acagactcgttttatccagccatgagacttatccttcctcagctggaaagagagagaatg
gcctatggaatcaaagagactatgcttgctaagctttacattgaactgcttaacctaccc
agagaaggaaaggacgcccttaagctcctgaattacaggacgcctactggagctcgtgca
gacgccggagacttcgcgatgattgcgtactttgtgttgaagcccagatgtttgcagaaa
ggcagtttaaccatccagcaagtaaatgacattttagactccattgccagcaataattct
gccaaaaggaaggacctggtaaagaagagtgttcttcagcttataactcagagttcagca
cttgaacagaagtggctgatacggatgattgtaaaggacctcaagcttggttttagtcag
aagactatattttctatttttcataatgatgcggaagagttgcacagtgtcaccacagat
ttggagaaagtctgtaggcagctgcatgaccctttggtcggactcagtgacatttctatc
actttattctcagcctttaaaccaatgctggctgccatagcggatattgagcgaatcgag
aaggacatgaaacaccagagtttctacatcgaaaccaagctagacggcgagcgcatgcag
atgcacaaagacggggatgtgtaccagtacttctcgcgaaacgggtacaactacgaggac
cagtttggtgcttccccacaggaaggctctctgacgccgttcattcacagtacattcaag
ccagacgtgcagaactgtatcctggacggtgagatgatggcctacaaccctcatacgcaa
acgtttatgcagaaggggaataagtttgatattaaacgaatggttgaagattctgatctg
caaacttgttactgtgtttttgatgtgttgatggttaataataaaaagctaggacatgag
accctgagaaacaggcatgaaattctgaatagtgttttcacaccaatcccaggtagaata
gaaatagtgcagaagacacaagcccagactaagaaagaggtagttgatgctttgaatgaa
gcaatagataaaagagaagagggaatcatggtaaagcatcctctttctatttacaagcca
gacaaacgaggtgaaggatggttaaaaattaaaccagagtatgttgatgaattgatggac
aaactggacatcttgattgtcggaggctattggggtaaaggttcacggggtggaatgatg
tctcattttttgtgtgctgtggcagagaagcccacttctggggaaaaaccatcagtgttt
catactctctgtcgtgttggctcaggttacaccatgaaagaactgtatgacctgggtttg
aaattggccaaacactggaagccttttcacaagaaggctccgcccagcagcattttatgt
ggaacagagaagccagaggtgtacattgaaccttgccactcggtcattgttcaggttaag
gccgcagagatcgtccccagtgacatgtataaaactggctgcacgttgcgttttccacga
attgaaaagataagagaagacaaagagtggcatgagtgcacaaccctggatgagctggag
caacttcgggggcaagcatctggaaagctcgcatctaaacaccttcacataggtggtgat
gacgaaccgcaagagaaaaagcgcaaagctgcccccaaggttaagaaagtcattggaatt
atcgagcacctaaaagcacctaacctctctaacataagcaaagtttctaatatatttgaa
gatgtggagttttgtgttatgagtggaacagacggccacccaaagcctgatctggagaac
agaattgcagaatttggtggttacatagtacagaatccaggcccagacacatactgcgtg
atcgcaggggctcagaacattagagtgaaaaacataatttcttcaaataagcatgatgtc
gtcaagcctgagtggcttttagagtgtttccagaccaaacgctgtgtgccctggcagcct
cgcgtcatgattcacatgtgcccatcaacaagagagcattttgcccgagagtatgactgc
tatggtgatagttactttgttgacacagatttgaatcaactgaaggaagtgttctcagga
attaaagatcctagggaacagactcctggagagatggccgctgtgatcgccgacttagaa
caccgctattcctgggacagctctcatctcagtatgtttcgaagccacactgtttatttg
gacttgtacactgttattaatgacttaagtaccaaaatcgagggaacaagattagctata
acagccttggagcttcgatttcatggagcaaaagtggtttcttgtttagccgagggcgtg
tcacacgtaatcgttggggaagatcgtagtcgtgttgcagattttaaagcttttcgaaga
gctcttaagagaaagtttaaaatcctacaagaatgttgggtaactgaatcaatagacaag
tgtgaattacaggaggaaaatcaatatttggtttaa

DBGET integrated database retrieval system