KEGG   Camelus ferus (Wild Bactrian camel): 102505811
Entry
102505811         CDS       T02979                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04218  Cellular senescence
cfr04350  TGF-beta signaling pathway
cfr04380  Osteoclast differentiation
cfr04390  Hippo signaling pathway
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05140  Leishmaniasis
cfr05142  Chagas disease
cfr05144  Malaria
cfr05145  Toxoplasmosis
cfr05146  Amoebiasis
cfr05152  Tuberculosis
cfr05161  Hepatitis B
cfr05166  Human T-cell leukemia virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05220  Chronic myeloid leukemia
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05321  Inflammatory bowel disease
cfr05323  Rheumatoid arthritis
cfr05410  Hypertrophic cardiomyopathy
cfr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102505811 (TGFB2)
   04350 TGF-beta signaling pathway
    102505811 (TGFB2)
   04390 Hippo signaling pathway
    102505811 (TGFB2)
   04068 FoxO signaling pathway
    102505811 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102505811 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102505811 (TGFB2)
   04218 Cellular senescence
    102505811 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102505811 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102505811 (TGFB2)
   05206 MicroRNAs in cancer
    102505811 (TGFB2)
   05205 Proteoglycans in cancer
    102505811 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102505811 (TGFB2)
   05212 Pancreatic cancer
    102505811 (TGFB2)
   05225 Hepatocellular carcinoma
    102505811 (TGFB2)
   05226 Gastric cancer
    102505811 (TGFB2)
   05220 Chronic myeloid leukemia
    102505811 (TGFB2)
   05211 Renal cell carcinoma
    102505811 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102505811 (TGFB2)
   05321 Inflammatory bowel disease
    102505811 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102505811 (TGFB2)
   05414 Dilated cardiomyopathy
    102505811 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102505811 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102505811 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102505811 (TGFB2)
   05161 Hepatitis B
    102505811 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102505811 (TGFB2)
   05144 Malaria
    102505811 (TGFB2)
   05145 Toxoplasmosis
    102505811 (TGFB2)
   05140 Leishmaniasis
    102505811 (TGFB2)
   05142 Chagas disease
    102505811 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102505811 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:cfr00536]
    102505811 (TGFB2)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102505811 (TGFB2)
Glycosaminoglycan binding proteins [BR:cfr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102505811 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102505811
NCBI-ProteinID: XP_006188217
LinkDB
Position
23
AA seq 514 aa
MNISTWGTTCLFFLKEFKQDTFFSRTLTLDCLQKFRIKKKKLPDLYLESCCFLFFFSYLF
LLFKKIFSTFKKMHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKL
KLTSPPEDYPEPEEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDM
PPFYPSETVCPVVTTPSGSVGSLCSRQPQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKN
ASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLS
FDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYT
SGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQPSNRRKKRALDAAYCFRNVQDNCCLR
PLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCC
VSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgaatatttccacttggggaacgacctgccttttctttttaaaagaattcaagcaagat
acctttttctctcggacactgactctcgattgtttgcaaaagtttcgcattaaaaaaaaa
aagctacctgatctgtacttggagagttgttgttttcttttttttttttcttacttgttt
ttactttttaaaaaaattttttccacctttaaaaaaatgcactactgtgtgctgagcgct
tttctgatcctgcatctggtcacggtcgcgctcagcctgtctacctgcagcacgctcgac
atggaccagttcatgcgcaagaggatcgaggcgatccgcgggcagatcctgagcaagctg
aagctcaccagccccccagaagactaccccgaacccgaggaggtccccccggaggtgatt
tccatctacaacagcaccagggacttgctccaggagaaggcgagccggagggcggccgcc
tgcgagcgcgagcggagcgacgaggagtactacgccaaggaggtttacaaaatagacatg
ccgcccttctacccctcggaaactgtctgcccagttgttacaacaccctctggctcagtg
ggcagcttgtgctccagacagccccaggtgctctgtgggtaccttgatgccatcccgccc
actttctacagaccctacttcagaattgtccgatttgacgtctcagcgatggagaagaat
gcttccaatttggtgaaggccgagttcagagtctttcgtttacagaaccccaaggccaga
gtcgcggaacaacggatcgagctgtatcagattctcaaatccaaagatttaacgtctcca
acccagcgctacatcgacagcaaagtcgtgaaaacgagagcggaaggtgaatggctgtcc
tttgatgtcacggatgctgttcacgaatggctccaccataaagataggaacctgggattt
aagataagtttacactgtccttgctgcacctttgtaccatctaataattacatcatcccc
aataaaagtgaagaactagaagcacgatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttgttgccctcctacagacttgagtcgcaaccatccaaccggcggaag
aagcgtgctttggatgcagcttattgctttagaaatgtgcaggataattgctgcctgcgt
ccactttacattgatttcaagagggatcttgggtggaaatggatacatgaacccaaaggg
tacaatgctaacttctgtgccggagcctgcccgtatctgtggagctcagacactcagcac
agcagggttctcagcttatataataccataaatccagaagcatctgcctccccttgctgc
gtgtcccaggatttagaaccgctaaccattctctactacatcggcaaaacacccaagatc
gaacagctttccaacatgatcgtaaagtcttgcaaatgcagctaa

KEGG   Camelus ferus (Wild Bactrian camel): 102509937
Entry
102509937         CDS       T02979                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 proprotein isoform X1
  KO
K13375  transforming growth factor beta-1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04218  Cellular senescence
cfr04350  TGF-beta signaling pathway
cfr04380  Osteoclast differentiation
cfr04390  Hippo signaling pathway
cfr04659  Th17 cell differentiation
cfr04672  Intestinal immune network for IgA production
cfr04926  Relaxin signaling pathway
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05140  Leishmaniasis
cfr05142  Chagas disease
cfr05144  Malaria
cfr05145  Toxoplasmosis
cfr05146  Amoebiasis
cfr05152  Tuberculosis
cfr05161  Hepatitis B
cfr05166  Human T-cell leukemia virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05220  Chronic myeloid leukemia
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05321  Inflammatory bowel disease
cfr05323  Rheumatoid arthritis
cfr05410  Hypertrophic cardiomyopathy
cfr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102509937 (TGFB1)
   04350 TGF-beta signaling pathway
    102509937 (TGFB1)
   04390 Hippo signaling pathway
    102509937 (TGFB1)
   04068 FoxO signaling pathway
    102509937 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102509937 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102509937 (TGFB1)
   04218 Cellular senescence
    102509937 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102509937 (TGFB1)
   04672 Intestinal immune network for IgA production
    102509937 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102509937 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102509937 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102509937 (TGFB1)
   05205 Proteoglycans in cancer
    102509937 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102509937 (TGFB1)
   05212 Pancreatic cancer
    102509937 (TGFB1)
   05225 Hepatocellular carcinoma
    102509937 (TGFB1)
   05226 Gastric cancer
    102509937 (TGFB1)
   05220 Chronic myeloid leukemia
    102509937 (TGFB1)
   05211 Renal cell carcinoma
    102509937 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102509937 (TGFB1)
   05321 Inflammatory bowel disease
    102509937 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102509937 (TGFB1)
   05414 Dilated cardiomyopathy
    102509937 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102509937 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102509937 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102509937 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102509937 (TGFB1)
   05161 Hepatitis B
    102509937 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102509937 (TGFB1)
   05144 Malaria
    102509937 (TGFB1)
   05145 Toxoplasmosis
    102509937 (TGFB1)
   05140 Leishmaniasis
    102509937 (TGFB1)
   05142 Chagas disease
    102509937 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cfr03110]
    102509937 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102509937 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:cfr00536]
    102509937 (TGFB1)
Chaperones and folding catalysts [BR:cfr03110]
 Intramolecular chaperones
  Others
   102509937 (TGFB1)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102509937 (TGFB1)
Glycosaminoglycan binding proteins [BR:cfr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102509937 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102509937
NCBI-ProteinID: XP_032341879
LinkDB
Position
9
AA seq 391 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENGDKI
YDKIKRSPHSIYMLFNTSEVREAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNDSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLTHREEIEGFRLSAHCSCDSKDNTLQVDINAGF
SSGRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctgccgctgctgtggctgctagtg
ctgacgcctggtcggccggccgccggactatccacctgcaagaccatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagattctgtccaagcttcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgccggaggccgtactggccctt
tacaacagtacccgcgaccgggtggccggggaaagtgccgaacccgagcccgagccagag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacggcgacaaaatc
tatgataaaatcaagcggagcccacacagcatatacatgctgtttaacacatcggaggtc
cgagaggcggtacccgaacccgtgttgctctctcgggcagagctgcgcctgctgaggctc
aagttaaaagcggagcagcacgtggagctgtaccagaaatatagcaacgattcctggcgc
tacctcagcaaccggctgctggcccccagcgactcaccggagtggctgtcctttgatgtc
actggagttgtgcggcagtggctgacccacagagaggaaatagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactccaagtggacattaacgcagggttc
agttctggccgccgaggtgatctcgccaccattcatggcatgaaccggcccttcctgctc
ctcatggccaccccgctggagagggcccagcacctgcacagctcccggcaccgccgagcc
ctggacaccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctctac
attgacttccgcaaggacctgggctggaagtggatccatgagcccaagggctaccacgcc
aatttctgcctggggccctgcccctacatttggagcctggacacgcagtacagcaaggtc
ctggcgctgtacaaccagcacaaccctggcgcgtcggcggcgccatgctgcgtaccgcag
gccctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Camelus ferus (Wild Bactrian camel): 102517948
Entry
102517948         CDS       T02979                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 proprotein
  KO
K13377  transforming growth factor beta-3
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04218  Cellular senescence
cfr04350  TGF-beta signaling pathway
cfr04390  Hippo signaling pathway
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05140  Leishmaniasis
cfr05142  Chagas disease
cfr05144  Malaria
cfr05145  Toxoplasmosis
cfr05146  Amoebiasis
cfr05152  Tuberculosis
cfr05161  Hepatitis B
cfr05166  Human T-cell leukemia virus 1 infection
cfr05200  Pathways in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05220  Chronic myeloid leukemia
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05321  Inflammatory bowel disease
cfr05323  Rheumatoid arthritis
cfr05410  Hypertrophic cardiomyopathy
cfr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102517948 (TGFB3)
   04350 TGF-beta signaling pathway
    102517948 (TGFB3)
   04390 Hippo signaling pathway
    102517948 (TGFB3)
   04068 FoxO signaling pathway
    102517948 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102517948 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102517948 (TGFB3)
   04218 Cellular senescence
    102517948 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102517948 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102517948 (TGFB3)
   05212 Pancreatic cancer
    102517948 (TGFB3)
   05225 Hepatocellular carcinoma
    102517948 (TGFB3)
   05226 Gastric cancer
    102517948 (TGFB3)
   05220 Chronic myeloid leukemia
    102517948 (TGFB3)
   05211 Renal cell carcinoma
    102517948 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102517948 (TGFB3)
   05321 Inflammatory bowel disease
    102517948 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102517948 (TGFB3)
   05414 Dilated cardiomyopathy
    102517948 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102517948 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102517948 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102517948 (TGFB3)
   05161 Hepatitis B
    102517948 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102517948 (TGFB3)
   05144 Malaria
    102517948 (TGFB3)
   05145 Toxoplasmosis
    102517948 (TGFB3)
   05140 Leishmaniasis
    102517948 (TGFB3)
   05142 Chagas disease
    102517948 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102517948 (TGFB3)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102517948 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102517948
NCBI-ProteinID: XP_006184523
LinkDB
Position
6
AA seq 456 aa
MHLLAKPQSSGSREAAWFSSLLLHVCWGLSFPRPRSPRASLLGSRMKMHLQRALVVLALL
NFATVSLSMSTCTTLDFDHIKRKRVEAIRGQILSKLRLTSPPDPSVLANIPTQVLDLYNS
TRELLEEVHGERGDDCTQENTESEYYAKEIYKFDMIQGLEEHNDLAVCPKGITSKIFRFN
VSSVEKNETNLFRAEFRVLRMPNPSSKRSEQRIELFQILQPDEHIAKQRYIDGKNLPTRG
TAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIQEVMEIKFKGVDS
EDDPGRGDLGRLKKKKEHSPHLILMMIPPDRLDNPGQGGQRKKRALDTNYCFRNLEENCC
VRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSTDTTHSSVLGLYNTLNPEASASP
CCVPQDMEPLTILYYVGRTAKVEQLSNMVVKSCKCS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctagggaggccgcctggttttcctcc
ctccttctgcacgtctgctggggtctctccttccccaggcctcgcagcccccgggcctca
ctcctcggctcccgcatgaagatgcacttgcaaagggctctggtggtcctggccctgctg
aactttgccacggtcagcctctccatgtccacttgcaccaccttggacttcgaccacatc
aagaggaagagggtggaagccattaggggacagatcttgagcaaactcaggctcaccagt
cccccggatccatcggtgttggccaacattcccacccaggtcctggacctttacaacagc
acccgagagctgctggaggaggtgcacggggagaggggagacgactgcactcaggaaaac
accgagtcagagtactatgccaaagaaatctataaattcgacatgatccaggggctggag
gaacacaatgatctggctgtctgccccaaaggaatcacctccaagattttccgtttcaac
gtgtcctcggtggagaaaaacgaaaccaacctgttccgagcggaattccgggtcttgcgg
atgcccaaccccagctccaagcgcagcgagcagaggattgagctcttccagatcctccag
ccagatgagcacatcgccaagcagcgctatattgacggcaagaacctgcccacgcggggc
actgctgagtggctgtcttttgacgtcaccgacactgtgcgtgaatggctcttgcgaaga
gagtccaacttaggtctggaaatcagcattcattgtccatgtcacacctttcagcccaat
ggggatatcctggaaaacattcaagaggtgatggaaatcaaattcaaaggtgtggacagt
gaggatgatccaggccgtggagatctggggcgacttaagaagaagaaggaacacagccct
catctcatcctcatgatgattcccccagaccggctggacaacccaggccaggggggtcag
aggaagaagcgggccctggacaccaattactgcttccgcaatttggaggagaactgctgc
gtgcgccctctctacattgacttccgacaggatctgggctggaaatgggtccatgaacct
aagggctactacgccaacttctgctcaggcccctgcccatacctccgcagtacagacaca
acccacagctcggtgctggggctgtacaacaccctgaacccggaagcctctgcgtcacct
tgctgcgtgccccaggacatggagcccctgaccatcctgtactatgtcgggaggaccgcc
aaggtggagcagctctctaacatggtggtgaagtcctgcaagtgtagctga

DBGET integrated database retrieval system