KEGG   Camelus ferus (Wild Bactrian camel): 102506039Help
Entry
102506039         CDS       T02979                                 

Definition
(RefSeq) programmed cell death protein 4
  KO
K16865  programmed cell death protein 4
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102506039
   05205 Proteoglycans in cancer
    102506039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MA3 HABP4_PAI-RBP1 PCI
Motif
Other DBs
NCBI-GeneID: 102506039
NCBI-ProteinID: XP_006194954
LinkDB All DBs
Position
Un
AA seq 469 aa AA seqDB search
MDVENEQMLSVNPSDPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDNGSEGLRSGVTVPNSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDEMAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSANDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIVMVLESTGESTFKMILDLLKSLWKSSTITLDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagaaaacgagcagatgctaagtgtaaacccttcagatcctgataatttaagt
gactctctcttttctggagatgaagaaaatgctgggactgaggaaataaaaaatgagata
aatggaaattggatttcagcatcctccattaatgaagctagaattaatgccaaggcaaaa
aggcgactacgaaaaaattcatcccgggactccggcagaggcgattcggtcagtgataat
ggaagtgaaggccttaggagtggagtcactgtaccgaacagtccaaagggaaggttgcta
gataggcgatccagatctgggaaaggaaggggactaccaaagaaaggcggtgctggaggc
aaaggtgtctggggtacacctgggcaggtgtatgatgtggaggaggtggatgtgaaagat
cctaactatgatgatgaccaggagaactgtgtttatgaaactgtagttttgcctttggat
gaaatggcatttgagaagactttaacaccaatcatacaggaatattttgagcatggagat
actaatgaagttgcggaaatgctaagagatttaaaccttggtgaaatgaaaagtggagta
ccagtattggcagtgtctttggcgttggagggaaaagctagtcatagagaaatgacatct
aagcttctttctgacctgtgtgggacagtaatgagcgcaaatgatgtagaaaaatcattt
gataaattgttgaaagatctacccgaattggcattggatactcctagagcgccacagttg
gtgggccagtttattgctagagctgttggagatggaattttatgtaatacctatattgat
agttacaaaggaactgtagattgtgtacaggctagagctgctctggacaaggctactgtg
ctcctgagtatgtctaaaggtggaaagcgcaaagacagtgtgtggggctctggaggtggg
cagcagtctgttaatcaccttgttaaagagattgatatgctgctgaaagagtatttactc
tctggagacatatctgaagctgaacattgccttaaggaactggaagtacctcattttcac
cacgagcttgtatatgaagccattgtaatggttttagagtcaactggagaaagtacattt
aagatgattttggatttattaaaatccctttggaaatcttctaccattactctagaccaa
atgaaaagaggttatgagagaatttacaatgaaattccagacattaatctggatgttcca
cattcatactctgtgcttgagcgatttgtagaagaatgttttcaggctggaataatttcc
aaacaactcagagatctttgtccttcaaggggtagaaaacgttttgtaagtgaaggagat
ggaggtcgtcttaaaccagagagctactga

KEGG   Camelus ferus (Wild Bactrian camel): 102522641Help
Entry
102522641         CDS       T02979                                 

Gene name
PDCD4
Definition
(RefSeq) programmed cell death protein 4
  KO
K16865  programmed cell death protein 4
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102522641 (PDCD4)
   05205 Proteoglycans in cancer
    102522641 (PDCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MA3 HABP4_PAI-RBP1 PCI
Motif
Other DBs
NCBI-GeneID: 102522641
NCBI-ProteinID: XP_006195399
LinkDB All DBs
Position
Un
AA seq 469 aa AA seqDB search
MDVENEQMLSVNPSDPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDNGSEGLRSGVTVPNSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDEMAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSANDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIVMVLESTGESTFKMILDLLKSLWKSSTITLDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagaaaacgagcagatgctaagtgtaaacccttcagatcctgataatttaagt
gactctctcttttctggagatgaagaaaatgctgggactgaggaaataaaaaatgagata
aatggaaattggatttcagcatcctccattaatgaagctagaattaatgccaaggcaaaa
aggcgactacgaaaaaattcatcccgggactccggcagaggcgattcggtcagtgataat
ggaagtgaaggccttaggagtggagtcactgtaccgaacagtccaaagggaaggttgcta
gataggcgatccagatctgggaaaggaaggggactaccaaagaaaggcggtgctggaggc
aaaggtgtctggggtacacctgggcaggtgtatgatgtggaggaggtggatgtgaaagat
cctaactatgatgatgaccaggagaactgtgtttatgaaactgtagttttgcctttggat
gaaatggcatttgagaagactttaacaccaatcatacaggaatattttgagcatggagat
actaatgaagttgcggaaatgctaagagatttaaaccttggtgaaatgaaaagtggagta
ccagtattggcagtgtctttggcgttggagggaaaagctagtcatagagaaatgacatct
aagcttctttctgacctgtgtgggacagtaatgagcgcaaatgatgtagaaaaatcattt
gataaattgttgaaagatctacccgaattggcattggatactcctagagcgccacagttg
gtgggccagtttattgctagagctgttggagatggaattttatgtaatacctatattgat
agttacaaaggaactgtagattgtgtacaggctagagctgctctggacaaggctactgtg
ctcctgagtatgtctaaaggtggaaagcgcaaagacagtgtgtggggctctggaggtggg
cagcagtctgttaatcaccttgttaaagagattgatatgctgctgaaagagtatttactc
tctggagacatatctgaagctgaacattgccttaaggaactggaagtacctcattttcac
cacgagcttgtatatgaagccattgtaatggttttagagtcaactggagaaagtacattt
aagatgattttggatttattaaaatccctttggaaatcttctaccattactctagaccaa
atgaaaagaggttatgagagaatttacaatgaaattccagacattaatctggatgttcca
cattcatactctgtgcttgagcgatttgtagaagaatgttttcaggctggaataatttcc
aaacaactcagagatctttgtccttcaaggggtagaaaacgttttgtaagtgaaggagat
ggaggtcgtcttaaaccagagagctactga

DBGET integrated database retrieval system