KEGG   Camelus ferus (Wild Bactrian camel): 102506204
Entry
102506204         CDS       T02979                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01523  Antifolate resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04137  Mitophagy - animal
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04218  Cellular senescence
cfr04380  Osteoclast differentiation
cfr04620  Toll-like receptor signaling pathway
cfr04621  NOD-like receptor signaling pathway
cfr04622  RIG-I-like receptor signaling pathway
cfr04623  Cytosolic DNA-sensing pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04657  IL-17 signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04668  TNF signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr04917  Prolactin signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04926  Relaxin signaling pathway
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05010  Alzheimer disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05030  Cocaine addiction
cfr05132  Salmonella infection
cfr05133  Pertussis
cfr05134  Legionellosis
cfr05135  Yersinia infection
cfr05140  Leishmaniasis
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05146  Amoebiasis
cfr05152  Tuberculosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05203  Viral carcinogenesis
cfr05212  Pancreatic cancer
cfr05215  Prostate cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfr05321  Inflammatory bowel disease
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102506204 (RELA)
   04014 Ras signaling pathway
    102506204 (RELA)
   04064 NF-kappa B signaling pathway
    102506204 (RELA)
   04668 TNF signaling pathway
    102506204 (RELA)
   04066 HIF-1 signaling pathway
    102506204 (RELA)
   04071 Sphingolipid signaling pathway
    102506204 (RELA)
   04024 cAMP signaling pathway
    102506204 (RELA)
   04151 PI3K-Akt signaling pathway
    102506204 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102506204 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102506204 (RELA)
   04218 Cellular senescence
    102506204 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102506204 (RELA)
   04621 NOD-like receptor signaling pathway
    102506204 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102506204 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102506204 (RELA)
   04625 C-type lectin receptor signaling pathway
    102506204 (RELA)
   04660 T cell receptor signaling pathway
    102506204 (RELA)
   04658 Th1 and Th2 cell differentiation
    102506204 (RELA)
   04659 Th17 cell differentiation
    102506204 (RELA)
   04657 IL-17 signaling pathway
    102506204 (RELA)
   04662 B cell receptor signaling pathway
    102506204 (RELA)
   04062 Chemokine signaling pathway
    102506204 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102506204 (RELA)
   04917 Prolactin signaling pathway
    102506204 (RELA)
   04926 Relaxin signaling pathway
    102506204 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102506204 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102506204 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    102506204 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102506204 (RELA)
   05202 Transcriptional misregulation in cancer
    102506204 (RELA)
   05203 Viral carcinogenesis
    102506204 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102506204 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102506204 (RELA)
   05221 Acute myeloid leukemia
    102506204 (RELA)
   05220 Chronic myeloid leukemia
    102506204 (RELA)
   05215 Prostate cancer
    102506204 (RELA)
   05222 Small cell lung cancer
    102506204 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102506204 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102506204 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    102506204 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    102506204 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102506204 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102506204 (RELA)
   04931 Insulin resistance
    102506204 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102506204 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102506204 (RELA)
   05135 Yersinia infection
    102506204 (RELA)
   05133 Pertussis
    102506204 (RELA)
   05134 Legionellosis
    102506204 (RELA)
   05152 Tuberculosis
    102506204 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102506204 (RELA)
   05170 Human immunodeficiency virus 1 infection
    102506204 (RELA)
   05162 Measles
    102506204 (RELA)
   05164 Influenza A
    102506204 (RELA)
   05161 Hepatitis B
    102506204 (RELA)
   05160 Hepatitis C
    102506204 (RELA)
   05168 Herpes simplex virus 1 infection
    102506204 (RELA)
   05163 Human cytomegalovirus infection
    102506204 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102506204 (RELA)
   05169 Epstein-Barr virus infection
    102506204 (RELA)
   05165 Human papillomavirus infection
    102506204 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102506204 (RELA)
   05145 Toxoplasmosis
    102506204 (RELA)
   05140 Leishmaniasis
    102506204 (RELA)
   05142 Chagas disease
    102506204 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102506204 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102506204 (RELA)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102506204 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Cuticle_3
Other DBs
NCBI-GeneID: 102506204
NCBI-ProteinID: XP_032345729
LinkDB
Position
10
AA seq 554 aa
MDDLFPLIFPAAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHP
TIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQ
CVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVL
SHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSF
SQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIE
EKRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPSRSSASIPKPAPQPYPFTPSLSTIN
FEEFSPMVFPSGQIPSQTSALAPAPAPVLAQTSAPAPAPAMASALAQAPAPVPVLAPGLA
QAVAPPAPKTNQAGEGTLTEALLQLQFDADEDLGALLGNNNDTAVFTDLASVDNSEFQQL
LNQGVPIAPHAAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLSGDEDFSSI
ADMDFSALLSQIGS
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggacgacctcttccctctcatcttcccggcggcagagccagcccaggcctctggtccc
tatgtggagatcatcgagcagcccaagcagcggggcatgcgctttcgctacaagtgcgag
ggccgctcagcaggcagtatcccaggagagaggagcacggataccaccaagacccacccc
accatcaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaag
gacccccctcaccggccccacccccatgagctcgtggggaaagactgccgggatggcttc
tatgaggctgagctctgccccgaccgctgcatccacagcttccagaacctggggatccag
tgtgtaaagaagcgggacctggagcaggccatcagtcagcgcatccagaccaacaataac
cccttccaagttcctatagaagagcagcgcggggactacgacctgaatgctgtgcgcctc
tgcttccaggtgacagtgcgggacccagcagggaggcccctccgcctgtcacctgtcctc
tctcatcctatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtg
aatcgaaactctgggagctgccttgggggggatgagatcttcctgctgtgtgacaaggtg
cagaaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttt
tcacaagctgatgtgcaccgacaagtggccattgttttccggacacccccctacgcagac
cccagcctgcaggcccctgtgcgcgtctccatgcagctgcggcggccttccgatcgggag
ctcagcgagcccatggaattccagtacttgccagacacagatgaccgtcaccggattgag
gagaaacgcaaaagaacatacgagacctttaagagcatcatgaaaaagagccctttcaat
ggccccaccgacccccggcctccaacccggcgcattgctgtgccttcccgcagctcagct
tccatccccaagccagctccccagccctatccatttacaccatctctcagcaccatcaat
tttgaggagttttcccccatggtctttccttctgggcagatcccaagccagacctcggcc
ttggcaccagcccctgccccagtcctggcccagacctcagcccctgcccctgccccagcc
atggcatcagccctggcccaggccccagcccctgtcccagtcctagccccaggccttgct
caggctgtggccccgcctgcccccaagaccaaccaggctggggaagggacactgacagag
gccctgctgcagctgcagtttgatgctgatgaagacctgggggccctgcttggcaataac
aacgacacagccgtgttcacagacctggcatctgtcgacaactctgagtttcagcagctg
ctgaaccagggtgtacccatagccccccacgcagctgagcccatgttgatggagtaccct
gaggctataactcgcctggtgaccgggtcccagaggccccctgacccagctcccaccccc
ctgggcgcctctgggctcaccaacggcctcctctcgggggatgaagacttctcttccatt
gcggacatggacttctcagcccttctgagtcagatcggctcctaa

DBGET integrated database retrieval system