KEGG   Camelus ferus (Wild Bactrian camel): 102506233
Entry
102506233         CDS       T02979                                 

Gene name
PRSS2
Definition
(RefSeq) trypsin-2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04080  Neuroactive ligand-receptor interaction
cfr04972  Pancreatic secretion
cfr04974  Protein digestion and absorption
cfr05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102506233 (PRSS2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102506233 (PRSS2)
   04974 Protein digestion and absorption
    102506233 (PRSS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102506233 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfr01002]
    102506233 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102506233 (PRSS2)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102506233 (PRSS2)
Peptidases and inhibitors [BR:cfr01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102506233 (PRSS2)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102506233 (PRSS2)
SSDB
Motif
Pfam: Trypsin DUF1986
Other DBs
NCBI-GeneID: 102506233
NCBI-ProteinID: XP_006185429
LinkDB
Position
7
AA seq 247 aa
MNPLLILAFVGAAVAVPTDDDDKIVGGYTCAENSVPYQVSLNSGYHFCGGSLISDQWVVS
AAHCYKSRIEVRLGENNIDVVEGTEQFISAAKVIRHPSYNSWTLDNDILLIKLSSPAVLS
TRVSTLALPTACAAAGTQCLISGWGNTLSSGVNYPELLQCLDAPLLSQAECEASYPGQIT
DNMVCAGFLEGGKDSCQGDSGGPVACNGELQGIVSWGYGCAQKNKPGVYTKVCNYVDWIE
ETIVANS
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaatccactcctgatccttgccttcgttggagcagctgttgctgtccccactgacgac
gatgacaagatcgtcgggggctacacctgtgcggagaattccgtcccctaccaggtgtcc
ctgaactccggctaccacttctgcgggggctccctcatcagcgaccagtgggtggtgtcc
gctgctcactgctacaagtcccgcatcgaggtgaggctgggagaaaacaacatcgatgtt
gtggagggcactgagcagttcatcagtgcggccaaggtcatccggcaccccagttacaac
agctggaccctggacaatgacatcctgctgatcaaactctcgtcgcctgcagtcctcagt
acccgggtgtccaccttagctctgcccaccgcctgcgcggctgctggcacccagtgcctc
atctctggctggggcaacaccctgagctctggcgtcaactaccctgagctgctgcagtgc
ctggacgcccccctgctgagccaggccgagtgtgaggcttcgtaccccggacagatcact
gacaacatggtctgcgccggcttcctggagggaggcaaggattcctgccagggtgattct
ggtggccctgtggcctgcaacggagagctccagggtatcgtctcctggggctatggctgc
gcccagaagaacaagcctggggtctacaccaaggtctgcaactatgtagactggattgag
gagaccatcgtggccaacagctaa

DBGET integrated database retrieval system