KEGG   Camelus ferus (Wild Bactrian camel): 102506236
Entry
102506236         CDS       T02979                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04114  Oocyte meiosis
cfr04115  p53 signaling pathway
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04211  Longevity regulating pathway
cfr04213  Longevity regulating pathway - multiple species
cfr04510  Focal adhesion
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04730  Long-term depression
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04913  Ovarian steroidogenesis
cfr04914  Progesterone-mediated oocyte maturation
cfr04935  Growth hormone synthesis, secretion and action
cfr04960  Aldosterone-regulated sodium reabsorption
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05205  Proteoglycans in cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05224  Breast cancer
cfr05410  Hypertrophic cardiomyopathy
cfr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102506236 (IGF1)
   04014 Ras signaling pathway
    102506236 (IGF1)
   04015 Rap1 signaling pathway
    102506236 (IGF1)
   04066 HIF-1 signaling pathway
    102506236 (IGF1)
   04068 FoxO signaling pathway
    102506236 (IGF1)
   04151 PI3K-Akt signaling pathway
    102506236 (IGF1)
   04152 AMPK signaling pathway
    102506236 (IGF1)
   04150 mTOR signaling pathway
    102506236 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102506236 (IGF1)
   04115 p53 signaling pathway
    102506236 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102506236 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102506236 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    102506236 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    102506236 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    102506236 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102506236 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    102506236 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102506236 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    102506236 (IGF1)
   04213 Longevity regulating pathway - multiple species
    102506236 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102506236 (IGF1)
   05202 Transcriptional misregulation in cancer
    102506236 (IGF1)
   05205 Proteoglycans in cancer
    102506236 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    102506236 (IGF1)
   05218 Melanoma
    102506236 (IGF1)
   05215 Prostate cancer
    102506236 (IGF1)
   05224 Breast cancer
    102506236 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102506236 (IGF1)
   05414 Dilated cardiomyopathy
    102506236 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102506236 (IGF1)
   01522 Endocrine resistance
    102506236 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102506236 (IGF1)
Cytokines and growth factors [BR:cfr04052]
 Growth factors
  Growth factors (RTK binding)
   102506236 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 102506236
NCBI-ProteinID: XP_006186103
LinkDB
Position
12
AA seq 159 aa
MGKISSLPTQLFKCCFCDFLKVKMHVTSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKYQPPSTNKKTKSQRRRKGSTFEEHK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtaaagatgcacgtcacgtcctcctcgcatctcttctacttggccctgtgcttgctc
accttcaccagctctgccacggctggacctgagacgctctgcggggctgagttggtggat
gctcttcagttcgtgtgcggagacaggggcttttatttcaacaagcccacggggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggacgagtgctgcttccggagctgt
gatctgaggaggctggagatgtactgcgcacccctcaagcctgccaagtcagcccgctcc
gtccgtgcccaacgccacaccgacatgcccaaggctcagaagtatcagcccccatctacc
aacaagaaaacgaagtctcagaggagaaggaaaggaagtacatttgaagaacacaagtag

DBGET integrated database retrieval system