KEGG   Camelus ferus (Wild Bactrian camel): 102506409
Entry
102506409         CDS       T02979                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04061  Viral protein interaction with cytokine and cytokine receptor
cfr04062  Chemokine signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04218  Cellular senescence
cfr04620  Toll-like receptor signaling pathway
cfr04621  NOD-like receptor signaling pathway
cfr04622  RIG-I-like receptor signaling pathway
cfr04657  IL-17 signaling pathway
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05132  Salmonella infection
cfr05133  Pertussis
cfr05134  Legionellosis
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05144  Malaria
cfr05146  Amoebiasis
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05219  Bladder cancer
cfr05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102506409 (CXCL8)
   04072 Phospholipase D signaling pathway
    102506409 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102506409 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102506409 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102506409 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102506409 (CXCL8)
   04621 NOD-like receptor signaling pathway
    102506409 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    102506409 (CXCL8)
   04657 IL-17 signaling pathway
    102506409 (CXCL8)
   04062 Chemokine signaling pathway
    102506409 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102506409 (CXCL8)
   05202 Transcriptional misregulation in cancer
    102506409 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    102506409 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102506409 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102506409 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102506409 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102506409 (CXCL8)
   05135 Yersinia infection
    102506409 (CXCL8)
   05133 Pertussis
    102506409 (CXCL8)
   05134 Legionellosis
    102506409 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102506409 (CXCL8)
   05171 Coronavirus disease - COVID-19
    102506409 (CXCL8)
   05164 Influenza A
    102506409 (CXCL8)
   05163 Human cytomegalovirus infection
    102506409 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102506409 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102506409 (CXCL8)
   05144 Malaria
    102506409 (CXCL8)
   05142 Chagas disease
    102506409 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102506409 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:cfr00536]
    102506409 (CXCL8)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  Chemokines
   102506409 (CXCL8)
Glycosaminoglycan binding proteins [BR:cfr00536]
 Heparan sulfate / Heparin
  Chemokines
   102506409 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 102506409
NCBI-ProteinID: XP_006188759
LinkDB
Position
2
AA seq 101 aa
MTSKLAVALLAAFLISAALCEAAVLSRLSSELRCQCINTHSTPFHPKFIKELRVIESGPH
CENTEIIVKLANGREVCLNPKEKWVQKVVEIFLKRAEKQNP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctctcttggcagctttcttgatttctgcagctctgtgt
gaagctgcagttctgtcaagactgagttcagaacttcgatgccagtgcataaatacacac
tccacacctttccaccccaaatttatcaaagaactaagagtgattgagagtggacctcac
tgtgaaaatacagaaatcattgttaagcttgccaatggaagagaggtctgcctgaatccc
aaggaaaagtgggtgcagaaggttgtggagatatttttgaagagagctgagaagcaaaat
ccatga

DBGET integrated database retrieval system