Camelus ferus (Wild Bactrian camel): 102506409 Help Entry 102506409         CDS       T02979                                  Gene name CXCL8 Definition (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr04060   Cytokine-cytokine receptor interaction cfr04061   Viral protein interaction with cytokine and cytokine receptor cfr04062   Chemokine signaling pathway cfr04064   NF-kappa B signaling pathway cfr04072   Phospholipase D signaling pathway cfr04218   Cellular senescence cfr04620   Toll-like receptor signaling pathway cfr04621   NOD-like receptor signaling pathway cfr04622   RIG-I-like receptor signaling pathway cfr04657   IL-17 signaling pathway cfr04932   Non-alcoholic fatty liver disease cfr04933   AGE-RAGE signaling pathway in diabetic complications cfr05132   Salmonella infection cfr05133   Pertussis cfr05134   Legionellosis cfr05135   Yersinia infection cfr05142   Chagas disease cfr05144   Malaria cfr05146   Amoebiasis cfr05161   Hepatitis B cfr05163   Human cytomegalovirus infection cfr05164   Influenza A cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05171   Coronavirus disease - COVID-19 cfr05200   Pathways in cancer cfr05202   Transcriptional misregulation in cancer cfr05219   Bladder cancer cfr05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102506409 (CXCL8)    04072 Phospholipase D signaling pathway     102506409 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102506409 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     102506409 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102506409 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102506409 (CXCL8)    04621 NOD-like receptor signaling pathway     102506409 (CXCL8)    04622 RIG-I-like receptor signaling pathway     102506409 (CXCL8)    04657 IL-17 signaling pathway     102506409 (CXCL8)    04062 Chemokine signaling pathway     102506409 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102506409 (CXCL8)    05202 Transcriptional misregulation in cancer     102506409 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     102506409 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     102506409 (CXCL8)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102506409 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     102506409 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     102506409 (CXCL8)    05135 Yersinia infection     102506409 (CXCL8)    05133 Pertussis     102506409 (CXCL8)    05134 Legionellosis     102506409 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     102506409 (CXCL8)    05171 Coronavirus disease - COVID-19     102506409 (CXCL8)    05164 Influenza A     102506409 (CXCL8)    05163 Human cytomegalovirus infection     102506409 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     102506409 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     102506409 (CXCL8)    05144 Malaria     102506409 (CXCL8)    05142 Chagas disease     102506409 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:cfr04052]     102506409 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:cfr00536]     102506409 (CXCL8) Cytokines and growth factors [BR:cfr04052]  Cytokines   Chemokines    102506409 (CXCL8) Glycosaminoglycan binding proteins [BR:cfr00536]  Heparan sulfate / Heparin   Chemokines    102506409 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102506409 NCBI-ProteinID:  XP_006188759 LinkDB All DBs Position 2 AA seq 101 aa AA seqDB search MTSKLAVALLAAFLISAALCEAAVLSRLSSELRCQCINTHSTPFHPKFIKELRVIESGPH CENTEIIVKLANGREVCLNPKEKWVQKVVEIFLKRAEKQNP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctgttgctctcttggcagctttcttgatttctgcagctctgtgt gaagctgcagttctgtcaagactgagttcagaacttcgatgccagtgcataaatacacac tccacacctttccaccccaaatttatcaaagaactaagagtgattgagagtggacctcac tgtgaaaatacagaaatcattgttaagcttgccaatggaagagaggtctgcctgaatccc aaggaaaagtgggtgcagaaggttgtggagatatttttgaagagagctgagaagcaaaat ccatga

DBGET integrated database retrieval system