KEGG   Camelus ferus (Wild Bactrian camel): 102506474Help
Entry
102506474         CDS       T02979                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr05034  Alcoholism
cfr05202  Transcriptional misregulation in cancer
cfr05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    102506474
  Immune diseases
   05322 Systemic lupus erythematosus
    102506474
  Substance dependence
   05034 Alcoholism
    102506474
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    102506474
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102506474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 102506474
NCBI-ProteinID: XP_014412655
UniProt: S9WX72
LinkDB All DBs
Position
Un
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccaagcagacggcccgcaagtccaccggcggtaaagcgccgcgcaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccacggag
ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgctatccacgccaagcgcgtcaccatc
atgcccaaggacattcagctcgcgcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system