KEGG   Camelus ferus (Wild Bactrian camel): 102506530Help
Entry
102506530         CDS       T02979                                 

Definition
(RefSeq) steroid 21-hydroxylase isoform X1
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00140  Steroid hormone biosynthesis
cfr01100  Metabolic pathways
cfr04925  Aldosterone synthesis and secretion
cfr04927  Cortisol synthesis and secretion
cfr04934  Cushing syndrome
Module
cfr_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102506530
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    102506530
   04927 Cortisol synthesis and secretion
    102506530
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102506530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cfr00199]
    102506530
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     102506530
Cytochrome P450 [BR:cfr00199]
 Cytochrome P450, animal type
  CYP21 family
   102506530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 102506530
NCBI-ProteinID: XP_032318627
LinkDB All DBs
Position
20
AA seq 533 aa AA seqDB search
MVPVGLLLLPLLLALLAGARLLWGQWKLRSLHLPPLVPGFLHLLQPNLPIYLLGLTQKLG
PIYRVRLGLQDVVVLNSKRTIEEAMVRKWVDFAGRPQIPSCKGRGRFGKKQGLWEAGKGR
PMASLVSSTPHPQPLLTDKLVSQHCEDISLGDYSLLWKAHKKLTRSALLLGIRNSMEPWV
EQLTQEFCERMRAQAGAPVTIQKEFSFLTCSIICYLTFGDKEETLVHAIHDCVQDLMKTW
DHWSLQMLDMVPFLRFFPNPSLWRLKQALENRDHIVEKQLRRHKESMVAGQWRDMVDYML
QGVGRPREGEGPGQLLEGHVHMSVVDLFIGGTETTAITLSWAVAFLLHHPEIQQRLQEEL
DHELGPRASGTRVPFKDRARLPLLNATIAEVLRLRPVVPLALPHRATRPSSIFGYDIPEG
MVVIPNLQGAHLDETVWEQPHEFRPDRFLGPGANPCVLAFGCGARVCLGEPLARLELFVV
LVHLLRAFTLLPPAGALPSLQPYPYCGLNLKIQPFQVRLQPREAEAPGLGECQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggtccccgtggggctgctgctgctgccgctgctgctggccctgctagccggggctcgc
ctgctgtggggccagtggaagctcaggagcctccacctcccccctcttgttcctggcttc
ttgcacctgctgcagcccaacctccccatctatctacttggcctgactcagaaactcggg
cctatctacagggtccgccttgggctgcaagatgtggtggtgctgaactccaagaggacc
attgaggaggccatggtcaggaagtgggtggacttcgctggcagaccccagataccatcc
tgtaaggggagggggcgtttcgggaagaagcaggggctgtgggaggcagggaagggcagg
cccatggcttccttggtcagttcgaccccccacccccaacccctactcacagacaagctg
gtgtctcagcactgtgaggacatctccctgggggactactccctgctctggaaggcccac
aagaagctcacccgctctgccctgctgctgggcatccgcaactccatggagccctgggtg
gagcagctgacccaggagttctgtgagcgcatgagagcccaggccggtgcccctgtgacc
atccagaaggaattctctttcctcacctgcagcatcatctgttaccttacctttggagac
aaggaggagaccttagtacatgccattcatgactgtgtccaagacttgatgaaaacctgg
gaccactggtccctccaaatgttggacatggttccctttctcaggttcttccccaacccc
agcctctggaggctgaagcaggccttggagaacagggaccacattgtagagaagcagctg
aggcggcacaaggagagcatggtggccggccagtggagggacatggtggactacatgctc
caaggggtggggaggccaagagagggagagggccctggacagctcctcgaagggcacgtg
catatgtctgtggtggaccttttcatcggtggcactgagaccacggcgataaccctttcc
tgggctgtggccttcctgcttcaccaccctgagattcagcagcgactgcaggaggagctg
gatcatgagctgggccccagagcctcaggtacccgagtcccattcaaggaccgggctcgg
ctgcccttgctcaacgccaccatcgcggaggtgctgcgcctgcggcccgttgtgcccctg
gccttgccgcaccgcgccacgcggcctagcagcatcttcggctatgacatccccgagggc
atggtggtcatccccaacctccaaggcgcccaccttgacgagacggtctgggagcagcct
cacgagttccggccggaccgcttcctgggcccgggcgccaacccctgcgtgttggcgttt
ggctgcggggcgcgcgtgtgcctgggcgagccgctggcgcgcctggagctcttcgtggtg
ctggtgcacctgctccgggccttcacgctgctgcctcccgcgggcgccttgccctcgctg
caaccctatccctactgcggcctcaacctcaagatacagcctttccaggtgcggctgcag
cctcgggaggcggaggccccgggtctgggagagtgccagtga

DBGET integrated database retrieval system