KEGG   Camelus ferus (Wild Bactrian camel): 102506629Help
Entry
102506629         CDS       T02979                                 

Gene name
ERBB3
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04020  Calcium signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102506629 (ERBB3)
   04012 ErbB signaling pathway
    102506629 (ERBB3)
   04020 Calcium signaling pathway
    102506629 (ERBB3)
   04151 PI3K-Akt signaling pathway
    102506629 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102506629 (ERBB3)
   05205 Proteoglycans in cancer
    102506629 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102506629 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102506629 (ERBB3)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102506629 (ERBB3)
Protein kinases [BR:cfr01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102506629 (ERBB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Furin-like Pkinase SKG6 Kinase-like
Motif
Other DBs
NCBI-GeneID: 102506629
NCBI-ProteinID: XP_006179891
LinkDB All DBs
Position
Un
AA seq 1338 aa AA seqDB search
MRVNAALQVLGFLLSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPRPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQN
TDCFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKICEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLHVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGLRSLKEISAGRVYISANRQLCYHHSLNWTRLLRGPSEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDACAQCAHFRDGPHCVSSCPFGVLGAKGPI
YKYPDAQNECRPCHENCTQGCKGPELQDCLGQTLALISKTHLAMALTVVIGLAVIFLILG
STFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLMHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIPPGAEPPALTNNELEEVELEPELDLDLELEAEEN
NLATTLGSALSLPLGTLNRPRGSQSLISPSSGYMPMNQGNLGEACQESAVCGGNERCPRP
ASLHPLPRGRLASESSEGHVTGSEAELQEKVSMCRSRSRSPRPRGDSAYHSQRHSLLTPV
TPQSPPGLEEEDVNGYVMPDAQFKGTSSREGTLSSVGLSSVLGTEEEEEDEEYEYMNRRR
RCSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLNPVPTMPNASTTPDEDYEYMN
RRRGGGGPGGDYAAMEACPAAEQGYEEMRAFQGPVHHAPQVQYAHLKTLRSLEATDSAFD
NPDYWHSRLFPKANAQRT
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgaacgcggctctgcaggtgttgggcttcctcctcagtctggcccggggctcc
gaggtgggcaactcgcaggcagtgtgccctgggactctgaatgggctgagtgtgactggc
gatgccgagaaccagtaccagacgctgtacaagctctacgagaggtgtgaggtggtgatg
gggaacctcgagattgtgctcacaggacacaacgctgacctctccttcctgcagtggatc
cgagaagtgactggctacgtccttgtggccatgaatgagttctctacgctgccactgccc
aacctccgagtggtgcgggggacccaggtctatgatgggaagttcgccatctttgtcatg
ttgaactacaacaccaactccagccatgccctgcgccagctccgcttcactcagctcact
gagattctgtcagggggcgtttacattgagaagaacgataaactttgccatatggacaca
attgactggagggacatcgtgcgggaccgagatgccgagatagtggtgaaggacaatggc
aggagctgtcccccgtgtcatgaggtctgcaaggggcgatgctggggtcccagaccagaa
gactgccagacattgaccaagaccatctgcgcccctcagtgtaatggtcactgctttggg
cccaaccccaaccagtgctgccatgacgagtgcgcagggggctgctcaggccctcagaac
acagactgctttgcttgccggctcttcaatgacagtggagcctgcgtgcgccagtgtcca
cagcctcttgtctacaacaagctaactttccagctagaacccaatccccacaccaagtat
cagtatggaggagtttgtgtcgccagctgtccccataactttgtagtggatcaaacgtct
tgtgtcagggcctgtcctcccgataagatggaagtagataaaaatggactcaagatatgt
gaaccttgtgggggtctgtgccccaaagcctgtgagggaacgggctctggaagccgcttc
cagactgtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaac
ctggactttcttatcactggcctcaatggagacccctggcacaagatccctgctctggac
cctgagaaactccatgtcttccggaccgtgcgggagatcacaggttacctgaacatccag
tcctggccaccccacatgcacaacttcagtgtcttttccaatctgacaaccattgggggc
agaagcctctacaaccggggcttctcattgttgatcatgaagaacttgaatgtaacatct
ctgggcctccgatcgttgaaagaaattagcgctgggcgtgtatacataagcgccaaccgg
cagctctgctaccaccattctctgaactggaccaggctgcttcgggggccttcagaagag
aggctggacatcaagcataaccggccccgcagggactgcgtggcagagggcaaagtgtgt
gacccactgtgctcctccgggggatgctggggcccaggccccggtcagtgcctatcctgc
cgaaactacagccgaggaggtgtctgtgtgacccactgcaacttcctgaatggggagcct
cgtgagtttgcccatgaggctgaatgcttctcctgccacccggaatgccagcccatggag
ggcacggccacgtgcaatggctcgggctctgatgcctgtgcccagtgtgcccattttcga
gatgggccccactgtgtgagtagctgcccatttggagtcctcggtgccaagggccccatc
tacaagtacccagatgctcagaatgaatgtcggccctgccatgagaactgcacccagggg
tgtaagggaccagagctacaagactgtttgggccaaacactggcactcatcagcaaaacc
catctggcaatggctttaacagtggtcataggattggcagtgattttcctgatcctgggc
agcacttttctctattggcgtgggcgccggattcagaataagagggctatgaggcgctac
ttggaacggggtgagagcatagagcctctggaccccagtgagaaggctaacaaagtgctg
gccagaatcttcaaagagacagagctgaggaagcttaaagtactgggctcgggtgtcttc
ggaactgtgcacaaaggagtatggattcctgagggtgaatcaatcaagattccagtctgc
attaaagtcattgaggacaagagtggacggcaaagtttccaagctgtgacggaccacatg
ctggccattggcagcctcgaccacgcccacattgttcggctgctgggactgtgtccaggg
tcatctctgcagctcgtcactcagtacttgcctctgggttccctgctggatcatgtgagg
caacaccgtggggcactggggccacagctgctgctcaactggggagtacaaattgccaag
ggaatgtactacctggaggagcatggtatggtgcataggaacctggctgcccgaaatgtg
ctgctgaagtcacccagtcaggtgcaggtggcagattttggggttgctgacttgctgccc
cctgatgataagcagctgatgcacagtgaggccaagactccaattaagtggatggccctc
gagagtatccactttgggaaatacacacaccagagtgacgtctggagctatggagtgaca
gtttgggagctgatgacctttggggcagagccctatgcagggctgcgactggctgaagta
ccagacctgctggagaaaggagaacggttggcgcagccccagatctgtaccattgatgtc
tacatggtcatggtcaagtgttggatgattgatgagaacattcgcccgacttttaaagag
ctagccaatgagttcactaggatggcccgagacccaccacggtacctggtcataaagaga
gagagtgggcctggaattccccctggagcagagcctcctgctctgacaaacaatgagctg
gaggaagtagagctggagccggaactagacctagacctggagttggaggcagaggagaac
aacctggcaaccacactgggctctgccctcagcctgccacttggaacactcaatcggcca
cgtgggagccagagccttataagtccatcatctggatatatgcctatgaaccaggggaat
cttggggaagcttgtcaggagtctgcagtttgtgggggtaatgaacggtgcccccgtcca
gcctctttgcacccattgccacggggacgcctggcttcagagtcatcggagggccatgtg
acaggctctgaggctgagctccaggagaaggtgtccatgtgtagaagccggagccggagt
ccacggccacgtggagacagtgcctaccattcccagcgccacagcctgcttactcctgtc
accccacagtctccaccaggattagaggaagaggatgtcaatggttatgtcatgccagat
gcacaattcaaaggtacctcctcccgggaaggcaccctttcttcagtgggtctcagttct
gtcctgggtactgaagaagaagaagaagatgaggagtatgaatacatgaaccggaggaga
aggtgcagtccacctcatccccctaggccaagttccctcgaggagctgggttatgaatac
atggatgtgggatcagacctcagtgcttccctgggcagcacacagagttgcccgctcaac
cccgtgcccaccatgcccaatgccagcacaactccagatgaggactatgaatatatgaat
cggcgacgtggtggaggtggtcctggaggggattatgcagccatggaagcctgcccagca
gctgagcaaggttatgaagaaatgagagctttccaggggcctgtacaccatgccccccaa
gttcaatatgcccacctcaaaactctgcggagtttagaagccactgactctgcctttgac
aaccctgattactggcacagcaggcttttccccaaggctaacgcccagagaacataa

DBGET integrated database retrieval system