KEGG   Camelus ferus (Wild Bactrian camel): 102506677
Entry
102506677         CDS       T02979                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04640  Hematopoietic cell lineage
cfr04916  Melanogenesis
cfr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102506677 (KITLG)
   04014 Ras signaling pathway
    102506677 (KITLG)
   04015 Rap1 signaling pathway
    102506677 (KITLG)
   04072 Phospholipase D signaling pathway
    102506677 (KITLG)
   04151 PI3K-Akt signaling pathway
    102506677 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102506677 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102506677 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102506677 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102506677 (KITLG)
Cytokines and growth factors [BR:cfr04052]
 Growth factors
  Growth factors (RTK binding)
   102506677 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102506677
NCBI-ProteinID: XP_032349538
LinkDB
Position
12
AA seq 274 aa
MKKTQTWIITCIYLQLFLFNPLVKTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDVLPSHCWISEMVAQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSSKSPEPRLFTPEKFFGIFNRSIDAFKDLEMAASKTSECVISSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNSIDDSNLQWAAMALPAFFSLIIGFAFGALYWKK
KQPNLTRAVENIQMNEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgttcctatttaat
cctctcgtcaaaactcaagggatctgcaggaaccgtgtaactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaggactataaaataaccctcaaatatgtccccggg
atggacgttttgcctagtcactgttggataagcgagatggtggcacagttgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgtgaaaatagtcgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacccaggctgtttactcctgaaaaattc
tttggaatttttaatagatccattgatgccttcaaggatttggagatggcggcatctaaa
actagtgaatgtgtgatttcttcaacattaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctccaattccattgatgactccaacctacaatgggcagccatggca
ttgccagcattcttttctctcataattgggtttgcttttggagccttatactggaagaag
aaacaacccaatctgacaagggcagttgaaaatatacagatgaatgaagaggataatgag
ataagtatgttgcaggaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system