KEGG   Camelus ferus (Wild Bactrian camel): 102506694
Entry
102506694         CDS       T02979                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04915  Estrogen signaling pathway
cfr05200  Pathways in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05223  Non-small cell lung cancer
cfr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102506694 (TGFA)
   04012 ErbB signaling pathway
    102506694 (TGFA)
   04014 Ras signaling pathway
    102506694 (TGFA)
   04151 PI3K-Akt signaling pathway
    102506694 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102506694 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102506694 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102506694 (TGFA)
   05212 Pancreatic cancer
    102506694 (TGFA)
   05225 Hepatocellular carcinoma
    102506694 (TGFA)
   05214 Glioma
    102506694 (TGFA)
   05211 Renal cell carcinoma
    102506694 (TGFA)
   05215 Prostate cancer
    102506694 (TGFA)
   05223 Non-small cell lung cancer
    102506694 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102506694 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 102506694
NCBI-ProteinID: XP_032353655
LinkDB
Position
15
AA seq 159 aa
MVTSAGQLALFALGVLLAVCQALENSTSALSDPPVAAAVVSHFNDCPDSHSQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcacctccgctggacagctcgccctcttcgcgctgggtgttttgttggctgtgtgc
caggccctggagaacagcacgtctgccctgagtgacccgccggtggctgcagctgtggtg
tcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgcagg
tttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgtcggtgcgcgc
tgtgaacacgcagacctcctggccgtggtggctgccagccagaagaagcaggccattacc
gccttggtggtggtctccatcgtggccctggctgtcctcatcatcacttgtgtgctgata
cactgctgccaagtccgaaaacactgtgagtggtgccgggccctcatctgccggcacgag
aagcccagtgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtctga

DBGET integrated database retrieval system