KEGG   Camelus ferus (Wild Bactrian camel): 102506774
Entry
102506774         CDS       T02979                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X1
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04068  FoxO signaling pathway
cfr04270  Vascular smooth muscle contraction
cfr04650  Natural killer cell mediated cytotoxicity
cfr04720  Long-term potentiation
cfr04726  Serotonergic synapse
cfr04730  Long-term depression
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr05010  Alzheimer disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05034  Alcoholism
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102506774 (ARAF)
   04012 ErbB signaling pathway
    102506774 (ARAF)
   04068 FoxO signaling pathway
    102506774 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102506774 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102506774 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102506774 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    102506774 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102506774 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102506774 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102506774 (ARAF)
   04720 Long-term potentiation
    102506774 (ARAF)
   04730 Long-term depression
    102506774 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102506774 (ARAF)
   05205 Proteoglycans in cancer
    102506774 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102506774 (ARAF)
   05212 Pancreatic cancer
    102506774 (ARAF)
   05225 Hepatocellular carcinoma
    102506774 (ARAF)
   05226 Gastric cancer
    102506774 (ARAF)
   05214 Glioma
    102506774 (ARAF)
   05221 Acute myeloid leukemia
    102506774 (ARAF)
   05220 Chronic myeloid leukemia
    102506774 (ARAF)
   05218 Melanoma
    102506774 (ARAF)
   05211 Renal cell carcinoma
    102506774 (ARAF)
   05219 Bladder cancer
    102506774 (ARAF)
   05215 Prostate cancer
    102506774 (ARAF)
   05213 Endometrial cancer
    102506774 (ARAF)
   05224 Breast cancer
    102506774 (ARAF)
   05223 Non-small cell lung cancer
    102506774 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102506774 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    102506774 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    102506774 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102506774 (ARAF)
   05160 Hepatitis C
    102506774 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102506774 (ARAF)
   01522 Endocrine resistance
    102506774 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102506774 (ARAF)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102506774 (ARAF)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102506774 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH C1_2 TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 102506774
NCBI-ProteinID: XP_032331494
LinkDB
Position
X
AA seq 611 aa
MEPSRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCRKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQFYHSVQDLSGGSRQHETPSSRPLNEPL
TPQGPSLSPASSCSQHRDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSSLIQLT
AQSFNTDAAGNRGGGDGAPRGSPGPASVSSGRKSPHSKSPSEQRERKPLADDKKKVKNLG
YRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEM
QVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQ
GMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAA
EVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIS
SNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELP
ACLLSAARLVP
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggagccatcgcggggcccccctgccaacggggccgagccgtcccgggcagtgggcacc
gtcaaagtgtacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtttacgactctctagacaaggccctcaaggtgcggggtctcaatcaggattgctgtgtg
gtctaccggctcatcaaggggcgaaagacagtcactgcctgggacacggccattgccccc
ctggatggcgaggagctcatcgtggaggtcctcgaagacgtcccgctgaccatgcacaat
tttgtacggaagacgttcttcagcctggcattttgtgacttctgccgtaagtttctgttc
catggcttccgctgccaaacctgtggatacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgtcgacatgagtaccaaccgccaacagttctaccacagtgtccaggat
ttgtccggaggctccagacagcatgagactccctcgagccgccccctgaatgagccgcta
acccctcagggtcccagcctttcccccgccagctcctgctcccagcaccgcgaccccgag
cacttccccttccctgccccggccaacgctcccctccagcgcatccgctccacgtccacc
cccaacgtccatatggtcagcaccacagcccccatggactccagcctcatccagctcact
gcccagagtttcaacaccgatgctgctggtaatagaggtggtggcgatggagctccccgg
gggagccctggcccggccagcgtgtcctcggggaggaagtccccacattccaagtcccct
tcagagcagcgggaacggaaacccttggccgacgacaagaagaaagtgaagaatctcggg
taccgggactcgggctattactgggaggtgccacccagtgaggtgcagctgctgaagagg
atcgggacgggctcgtttggcaccgtgtttcgcgggcggtggcatggtgatgtggccgtg
aaggtgctcaaggtggcccaacccacagctgagcaggcccaggccttcaagaacgagatg
caggtgctcaggaagacccggcacgtcaacatcttgctgttcatgggcttcatgacccgg
ccgggatttgccatcatcacacagtggtgcgagggctccagtctctaccaccacctgcat
gtggccgacacgcgcttcgacatggtccagctcattgatgtggcccggcagacggcccag
ggcatggactacctccatgccaagaacatcatccaccgagatctcaagtctaacaacatc
ttcctacatgaggggctcacggtgaagatcggggactttggcttggccacagtgaagacg
cggtggagcggggcccagcccttggagcagccctcgggctcggtgctgtggatggcggct
gaggtgatccgtatgcaggacccaaacccctacagcttccagtcggatgtctacgcctat
ggggttgtgctctacgagctcatgaccggctcactgccttacagccacattggcagccgt
gaccagattatctttatggtgggccgtggctatctgtccccggacctcagcaaaatctcc
agcaactgccccaaggccatgcggcgcctcctgtctgattgcctcaagttccaacgggag
gagcggcctctcttcccccagatcctggccacgattgagctgctgcagcggtcactcccc
aagattgagcggagtgcctccgaaccctccttgcaccgtacccaggctgatgagttgcct
gcctgcctactcagcgcagcccgccttgtgccttag

KEGG   Camelus ferus (Wild Bactrian camel): 102517521
Entry
102517521         CDS       T02979                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04022  cGMP-PKG signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04068  FoxO signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04218  Cellular senescence
cfr04270  Vascular smooth muscle contraction
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04371  Apelin signaling pathway
cfr04510  Focal adhesion
cfr04540  Gap junction
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04613  Neutrophil extracellular trap formation
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04650  Natural killer cell mediated cytotoxicity
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr04720  Long-term potentiation
cfr04722  Neurotrophin signaling pathway
cfr04726  Serotonergic synapse
cfr04730  Long-term depression
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04912  GnRH signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04915  Estrogen signaling pathway
cfr04916  Melanogenesis
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04926  Relaxin signaling pathway
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr04929  GnRH secretion
cfr04935  Growth hormone synthesis, secretion and action
cfr05010  Alzheimer disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05034  Alcoholism
cfr05132  Salmonella infection
cfr05152  Tuberculosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102517521 (RAF1)
   04012 ErbB signaling pathway
    102517521 (RAF1)
   04014 Ras signaling pathway
    102517521 (RAF1)
   04015 Rap1 signaling pathway
    102517521 (RAF1)
   04370 VEGF signaling pathway
    102517521 (RAF1)
   04371 Apelin signaling pathway
    102517521 (RAF1)
   04630 JAK-STAT signaling pathway
    102517521 (RAF1)
   04068 FoxO signaling pathway
    102517521 (RAF1)
   04072 Phospholipase D signaling pathway
    102517521 (RAF1)
   04071 Sphingolipid signaling pathway
    102517521 (RAF1)
   04024 cAMP signaling pathway
    102517521 (RAF1)
   04022 cGMP-PKG signaling pathway
    102517521 (RAF1)
   04151 PI3K-Akt signaling pathway
    102517521 (RAF1)
   04150 mTOR signaling pathway
    102517521 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102517521 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    102517521 (RAF1)
   04218 Cellular senescence
    102517521 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102517521 (RAF1)
   04540 Gap junction
    102517521 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102517521 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102517521 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102517521 (RAF1)
   04625 C-type lectin receptor signaling pathway
    102517521 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    102517521 (RAF1)
   04660 T cell receptor signaling pathway
    102517521 (RAF1)
   04662 B cell receptor signaling pathway
    102517521 (RAF1)
   04664 Fc epsilon RI signaling pathway
    102517521 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    102517521 (RAF1)
   04062 Chemokine signaling pathway
    102517521 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102517521 (RAF1)
   04929 GnRH secretion
    102517521 (RAF1)
   04912 GnRH signaling pathway
    102517521 (RAF1)
   04915 Estrogen signaling pathway
    102517521 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    102517521 (RAF1)
   04917 Prolactin signaling pathway
    102517521 (RAF1)
   04921 Oxytocin signaling pathway
    102517521 (RAF1)
   04926 Relaxin signaling pathway
    102517521 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    102517521 (RAF1)
   04919 Thyroid hormone signaling pathway
    102517521 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    102517521 (RAF1)
   04916 Melanogenesis
    102517521 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102517521 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    102517521 (RAF1)
   04720 Long-term potentiation
    102517521 (RAF1)
   04730 Long-term depression
    102517521 (RAF1)
   04722 Neurotrophin signaling pathway
    102517521 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    102517521 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102517521 (RAF1)
   05206 MicroRNAs in cancer
    102517521 (RAF1)
   05205 Proteoglycans in cancer
    102517521 (RAF1)
   05230 Central carbon metabolism in cancer
    102517521 (RAF1)
   05231 Choline metabolism in cancer
    102517521 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102517521 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102517521 (RAF1)
   05212 Pancreatic cancer
    102517521 (RAF1)
   05225 Hepatocellular carcinoma
    102517521 (RAF1)
   05226 Gastric cancer
    102517521 (RAF1)
   05214 Glioma
    102517521 (RAF1)
   05221 Acute myeloid leukemia
    102517521 (RAF1)
   05220 Chronic myeloid leukemia
    102517521 (RAF1)
   05218 Melanoma
    102517521 (RAF1)
   05211 Renal cell carcinoma
    102517521 (RAF1)
   05219 Bladder cancer
    102517521 (RAF1)
   05215 Prostate cancer
    102517521 (RAF1)
   05213 Endometrial cancer
    102517521 (RAF1)
   05224 Breast cancer
    102517521 (RAF1)
   05223 Non-small cell lung cancer
    102517521 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102517521 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    102517521 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    102517521 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102517521 (RAF1)
   05152 Tuberculosis
    102517521 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102517521 (RAF1)
   05161 Hepatitis B
    102517521 (RAF1)
   05160 Hepatitis C
    102517521 (RAF1)
   05164 Influenza A
    102517521 (RAF1)
   05163 Human cytomegalovirus infection
    102517521 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102517521 (RAF1)
   05165 Human papillomavirus infection
    102517521 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102517521 (RAF1)
   01522 Endocrine resistance
    102517521 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102517521 (RAF1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102517521 (RAF1)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102517521 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 102517521
NCBI-ProteinID: XP_032314898
LinkDB
Position
17
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTLGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
TTSSPSSEGSLSQRQRSTSTPNVHMVSTALPVDSRAIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSSRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacaaggggcctggaagacgatcagcaatggttttggattcaaagatgcg
gtgtttgatggctccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcatcagatgatggcaaactcacggattcttctaagacaagcaacactatccgtgtt
tttttgccaaacaagcaaagaacagtggtcaatgtgcggaacggaatgagcctgcacgat
tgccttatgaaagctctcaaggtgcggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaagggtaaaaaagcacgtttagattggaatactgacgctgcctcg
ctgattggagaggaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagaccttcctgaagcttgccttctgtgatatctgtcagaagttcctgctc
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaacatcaggcaactcttattgtttccaaattcaact
ctcggtgacagtggggtcccagcactgccctccttgacgatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccacgctttcacattc
accacctccagcccctcttctgaaggttccctctcccagaggcagaggtcgacgtctacg
cctaacgtccacatggtcagcaccgccctgcctgtggacagcagggcgatcgaggatgca
attcgaagccacagtgaatcagcctcaccttcagccttgtccagcagccccaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccggcacagagagagcgggcacca
ggatccgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccactcggattgggtcaggctccttt
ggaactgtttataagggcaagtggcatggagatgttgcagtaaagatcctcaaggttgtg
gaccccaccccagagcagttccaggccttcaggaatgaggtggctgtccttcgcaaaaca
cggcacgtgaacatcctgctcttcatgggctacatgacaaaggacaacctggccattgtg
acccagtggtgcgagggcagcagcctctacaaacacctgcatgtgcaggagaccaagttc
cagatgttccagttgattgacatcgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagatttcggtttggcaacagtcaagtcacgctggagtggttctcag
caggttgaacaacccactggctccatcctgtggatggccccagaggtgatccgaatgcag
gataataacccgttcagcttccagtctgacgtctactcctacggcatcgtgctgtacgag
ctcatgaccggcgagctcccttactcccacatcaacaaccgcgaccagatcatcttcatg
gtgggccgagggtacgcctcccccgacctcagcaagctgtacaagaactgccccaaagcg
atgaagaggctggtggccgactgtgtgaagaaagtcaaggaggagaggcctctgtttccc
cagatcctgtcttccatcgaactgctgcagcactctctgccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccacaccgaggacatcaacgcctgcacgctgacc
acgtcctctaggctgcccgtcttctag

KEGG   Camelus ferus (Wild Bactrian camel): 102524100
Entry
102524100         CDS       T02979                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04068  FoxO signaling pathway
cfr04150  mTOR signaling pathway
cfr04270  Vascular smooth muscle contraction
cfr04510  Focal adhesion
cfr04650  Natural killer cell mediated cytotoxicity
cfr04720  Long-term potentiation
cfr04722  Neurotrophin signaling pathway
cfr04726  Serotonergic synapse
cfr04730  Long-term depression
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04914  Progesterone-mediated oocyte maturation
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr04934  Cushing syndrome
cfr05010  Alzheimer disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05034  Alcoholism
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05216  Thyroid cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102524100 (BRAF)
   04012 ErbB signaling pathway
    102524100 (BRAF)
   04015 Rap1 signaling pathway
    102524100 (BRAF)
   04068 FoxO signaling pathway
    102524100 (BRAF)
   04024 cAMP signaling pathway
    102524100 (BRAF)
   04150 mTOR signaling pathway
    102524100 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102524100 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102524100 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102524100 (BRAF)
   04062 Chemokine signaling pathway
    102524100 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102524100 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    102524100 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102524100 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102524100 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102524100 (BRAF)
   04720 Long-term potentiation
    102524100 (BRAF)
   04730 Long-term depression
    102524100 (BRAF)
   04722 Neurotrophin signaling pathway
    102524100 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102524100 (BRAF)
   05205 Proteoglycans in cancer
    102524100 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102524100 (BRAF)
   05212 Pancreatic cancer
    102524100 (BRAF)
   05225 Hepatocellular carcinoma
    102524100 (BRAF)
   05226 Gastric cancer
    102524100 (BRAF)
   05214 Glioma
    102524100 (BRAF)
   05216 Thyroid cancer
    102524100 (BRAF)
   05221 Acute myeloid leukemia
    102524100 (BRAF)
   05220 Chronic myeloid leukemia
    102524100 (BRAF)
   05218 Melanoma
    102524100 (BRAF)
   05211 Renal cell carcinoma
    102524100 (BRAF)
   05219 Bladder cancer
    102524100 (BRAF)
   05215 Prostate cancer
    102524100 (BRAF)
   05213 Endometrial cancer
    102524100 (BRAF)
   05224 Breast cancer
    102524100 (BRAF)
   05223 Non-small cell lung cancer
    102524100 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102524100 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    102524100 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    102524100 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102524100 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102524100 (BRAF)
   05160 Hepatitis C
    102524100 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102524100 (BRAF)
   01522 Endocrine resistance
    102524100 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102524100 (BRAF)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102524100 (BRAF)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102524100 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102524100
NCBI-ProteinID: XP_032340257
LinkDB
Position
7
AA seq 660 aa
MAALSGGGGAEQGQALFNGDMEPEAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLD
KFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSSSSS
SLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALM
MRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLA
FCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEAS
LAETALTSGSSSSAPPSDSIGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSA
PNVHINTIEPVNIDDLIRDQGFRSDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEIVFDFE
PGPVFRGSWALLSCFHPKQTKYKLQILFVPHPHSVCLYYLHAKSIIHRDLKSNNIFLHED
LTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLY
ELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLF
PQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggtggcggcgcggagcagggccaggctctgttcaacggggac
atggagcccgaggccggcgctgcggcctcttcggctgcggaccctgccattcccgaggag
gtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaggccctattggac
aaatttggtggggagcataatccaccatcaatatatctggaggcctatgaagaatacacc
agcaagctagatgccctccaacaaagagaacaacagttattggaatccctggggaatgga
actgatttttctgtttctagctctgcatcaacggacaccgttacatcttcttcctcttct
agcctttcagtgctgccttcatctctttcagtttttcaaaaccccacagatgtgtcacgg
agcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgcccaataaacagagg
acagtggtacctgcaaggtgtggagttacagttcgggacagtctaaagaaagcactgatg
atgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatggagagaagaaa
ccaattggctgggatactgatatttcctggcttaccggagaggaattgcatgtagaagtg
ttggagaatgttccacttacaacacacaactttgtacggaaaacttttttcaccttagca
ttttgtgacttctgtcgaaagctgcttttccaggggttccgctgtcaaacatgtggttat
aaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgaccaactt
gatttgctgtttgtctccaagttctttgaacaccacccaataccacaggaggaggcctcc
ttagcagagactgcccttacgtctgggtcatcctcgtctgcacccccctccgattctatt
gggcccccaattctcaccagtccgtctccttcaaaatccattccaattccacagcctttc
cgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccggtcctcgtcagct
ccaaatgtgcatataaacacaatagaacccgtcaatattgatgacttgattagagaccaa
gggtttcgtagtgatggagcccctttgaaccagctgatgcgctgtcttcggaaataccaa
tcccggactcccagtcccctcctacattctgtccccagtgaaatagtgtttgattttgag
cctggcccagtgttcagaggtagttgggctcttctttcttgttttcacccaaagcaaact
aaatataaactacagatactgtttgtgcctcaccctcacagtgtgtgtttgtattactta
cacgccaagtcaatcatccacagagacctcaagagtaataatatttttcttcatgaagac
ctcacagtaaaaataggtgactttggtctagccacagtgaaatctcgatggagtgggtcc
catcagtttgaacaattgtctggatccattttgtggatggcaccagaagtaatcagaatg
caagataaaaacccatatagctttcaatcagatgtgtatgcatttgggattgttctgtat
gaattgatgactggacagttaccttattcaaacatcaacaacagagaccagataattttt
atggtgggacgaggatatctgtctccagatctcagtaaggtacggagtaactgtccaaaa
gccatgaagagattaatggcagagtgcctaaaaaagaaaagagatgagagaccactcttt
ccccaaattctcgcctctattgagctgctggcccgctcattgccaaaaattcaccgcagt
gcatcagaaccctccttgaatcgggctggcttccagacagaggattttagtctgtatgct
tgtgcttctccaaaaacacccatccaagcagggggatatggagaatttgcagccttcaag
tag

DBGET integrated database retrieval system