KEGG   Camelus ferus (Wild Bactrian camel): 102506911
Entry
102506911         CDS       T02979                                 

Gene name
DAPK2
Definition
(RefSeq) death-associated protein kinase 2 isoform X2
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04140  Autophagy - animal
cfr05200  Pathways in cancer
cfr05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102506911 (DAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102506911 (DAPK2)
  09162 Cancer: specific types
   05219 Bladder cancer
    102506911 (DAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102506911 (DAPK2)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102506911 (DAPK2)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   102506911 (DAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kdo RIO1 Glycos_trans_3N MIP-T3_C
Other DBs
NCBI-GeneID: 102506911
NCBI-ProteinID: XP_014414159
LinkDB
Position
6
AA seq 465 aa
MCCPPGFCGQFAIVKRCREKSTGLEYAAKFIKKRQSQASRRGVCREEIQREVSILRQVLH
PNVITLHDVFENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHAK
KIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEP
LGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYNFDEEFFSQTSELAKDFIR
KLLVKETRKRLTIQEALSHPWITSKGEIRTPEQQKAEPVQLKTKRLREYTLKCHSSMPPN
NTYVNFERFARVVEDVARVDQGCRALAGAHDTIQDDVETLVSIYNEKEAWYREESESARH
DLSQLRYEFRKVESLKKLLREDIRATGYGLGSVARKLDHLQVRFEALRQELSADLQWLQE
LVGSFQLESGSVDSLGSVFRRDAGDFPGELLSRSCSEEVLASLKL
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgtgctgcccacctggcttttgcggccagtttgccattgtgaagaggtgccgggagaag
agcacggggctggagtacgcagccaagttcatcaagaagcggcagagccaggccagccgg
cggggcgtgtgccgggaggagatccagcgggaggtgagcatcctacggcaggtgctgcac
cccaacgtcatcacgctgcacgacgtcttcgagaaccgcaccgacgtggtgctcatcctc
gagctagtgtccggaggagagctcttcgacttcctggcccagaaggagtcactgagtgag
gaggaggccactagcttcattaagcagatcctggacggggtgaactaccttcatgccaag
aaaattgctcactttgatctcaagccagaaaacattatgttgttggacaagaatattccc
attccacacatcaagctgattgactttggcctggctcatgaaatagaagatggagttgaa
tttaagaacatttttgggacgccagaatttgttgctccagaaattgtgaactatgagccc
ctgggactggaggctgacatgtggagcattggcgtcatcacctacatcctcttgagtgga
gcatcccctttcctcggagacacgaagcaggaaacgctggcaaatatcacagcagtgagt
tacaactttgacgaggaattcttcagccagaccagcgagctagccaaggacttcattcgg
aagcttctggttaaagagacccggaaacggctcacgatccaagaggccctcagtcacccc
tggatcacgtccaaaggagagatcagaaccccagaacagcagaaggcagagcccgtccag
ctgaagaccaagcgcctgagagagtacaccctcaaatgccactcaagcatgccccccaac
aacacctacgtcaactttgagcgttttgcccgagtggtggaggatgtggctagggtggac
caggggtgccgtgccttggcgggggcccacgacaccatccaggacgatgtggagaccctg
gtctccatctacaatgagaaggaggcttggtaccgagaagagagcgaaagtgcccggcac
gacctgtcccagctcaggtacgagttccgcaaagtggagtccttgaagaagctcctgcga
gaggacatccgggccacagggtacggcctcggaagcgtggccaggaaattggaccatctg
caggtgcggtttgaagctctgaggcaggagctctcggcagacctacagtggctccaggaa
ctggtgggcagcttccagctggagagtgggagcgtggacagcctgggctccgtgttccgc
cgggacgctggggacttcccaggggaactgctcagcagatcatgcagtgaggaagtcttg
gccagcttgaagctctga

KEGG   Camelus ferus (Wild Bactrian camel): 102510747
Entry
102510747         CDS       T02979                                 

Gene name
DAPK3
Definition
(RefSeq) death-associated protein kinase 3
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04140  Autophagy - animal
cfr05200  Pathways in cancer
cfr05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102510747 (DAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102510747 (DAPK3)
  09162 Cancer: specific types
   05219 Bladder cancer
    102510747 (DAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102510747 (DAPK3)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102510747 (DAPK3)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   102510747 (DAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Choline_kinase DUF3847 APH
Other DBs
NCBI-GeneID: 102510747
NCBI-ProteinID: XP_032321821
LinkDB
Position
22
AA seq 454 aa
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRREDSSRKPERRRLKTA
RLKEYTIKSHSSMPPNNTYINFERFSKVLEEVAAAEEGLRGLEHSRRLFHEDIEALTAIY
EEKEAWYREENESIGQDLRRLRQELHKTEALQRQAQEEAKGALLGARGLKRRFSRLESRY
EALAKQVASEMRFVQDLVRAMEREKLQGGECSLR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtccacattcaggcaggaagatgtggaagaccactatgagatgggggaggagctgggc
agcggccagtttgcgattgtgcggaaatgccggcagaagggcaccgggaaggagtatgca
gccaagttcatcaagaagcgccgcctgtcatccagccggcggggtgtgagccgggaggag
atcgagcgggaggtgaacatcctgcgggagatccggcaccccaacatcatcacgctgcac
gacatctttgagaacaagactgacgtggtgctcatcctggagctggtctcgggcggggag
ctcttcgacttcctggccgagaaggagtccctgacggaagacgaggccactcagttcctc
aagcagatcctggacggcgtccactacctgcactccaagcgcatcgcccacttcgacctc
aagccagagaacatcatgctcttggacaagaacgtgcccaacccgcggatcaagctcatt
gacttcggcatcgcccacaagatcgaagcagggaacgagttcaagaacatcttcggcacc
ccagagtttgtggctcccgagattgtcaactacgagcccctgggtctggaggcagacatg
tggagtatcggcgtcatcacctatatcctcttgagcggcgcatccccgttcctgggcgag
accaagcaggagaccctgactaacatctcggccgtgaactacgactttgacgaggagtac
ttcagcaacaccagcgagctggccaaggacttcatccgccggctgctcgtcaaagacccc
aagaggaggatgaccatcgcccagagcctggagcattcctggatcaaggccatccggcgg
cggaacgtgcggcgggaggacagcagccggaagccagagcggcggcgcctgaagaccgcc
cgcctcaaggagtacaccatcaagtcacactcgagcatgccccccaacaacacctacatc
aacttcgagcgcttctccaaggtgctggaggaggtggcagcggctgaggagggcctgcgt
gggctcgagcacagccgacgcctgttccacgaggacatcgaggcgctgacagccatctac
gaggagaaggaggcctggtaccgtgaggagaacgagagcatcggccaggacctgcggcgg
ctgcggcaggaactgcacaagaccgaggcgctccagcggcaggctcaggaggaggccaag
ggcgccctgctgggggcccgcgggctcaagcgccgcttcagccgcctggagagccgctac
gaggcgctggccaagcaggtggcctcagaaatgcggtttgtgcaggatctggtgcgcgcc
atggagcgggagaagctgcagggtggggagtgcagcctccgctag

KEGG   Camelus ferus (Wild Bactrian camel): 102512779
Entry
102512779         CDS       T02979                                 

Gene name
DAPK1
Definition
(RefSeq) LOW QUALITY PROTEIN: death-associated protein kinase 1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04140  Autophagy - animal
cfr05200  Pathways in cancer
cfr05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102512779 (DAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102512779 (DAPK1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102512779 (DAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102512779 (DAPK1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102512779 (DAPK1)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   102512779 (DAPK1)
SSDB
Motif
Pfam: Pkinase Ank_2 Ank_5 Ank_4 Ank Ank_3 PK_Tyr_Ser-Thr Death COR Kdo RIO1 O_Spanin_T7 AAA_23 Choline_kinase APH ABC_tran
Other DBs
NCBI-GeneID: 102512779
NCBI-ProteinID: XP_032333366
LinkDB
Position
4
AA seq 1430 aa
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIVHAINDDNVPGL
QHLLGSLSSYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAIYWAS
RHGHVDTLKFLHENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPNFQDKEEET
PLHCAAWHGYYSVAKALCETGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
DKDGHIALHLAVRRCQMEVIHTLISQGCSVDFQDRHGNTPLHVACKDGNVPIVVALCEAG
CNLDLSNKYGRTPLHLAANNGILDVVRYLCLTGANVEALTSDGKTAEDLAKSEQHEHVAG
LLTRLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFGAP
AHHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHAIVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEADLRHIAQQLHSVGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDVQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDNLHRSWTDEEDEVRVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVNGCKIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMVYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDLVAKYNTNNGAPKEFLPSPVHALLREWTSYPESTVGILMSKL
RELGRRDAADFLLKASSVFKINLDGSGQEAYASSCNSGTSYNSISSVVSR
NT seq 4293 nt   +upstreamnt  +downstreamnt
atgaccgtgttcaggcaggaaaacgtggatgactactatgacaccggcgaggaacttggc
agtgggcagtttgcagttgtgaagaaatgccgtgagaaaagcactggtctacagtatgca
gccaaattcatcaagaaaaggaggaccaaatccagccggcggggtgtgagccgggaggac
atcgagcgggaggtcagcatcctgaaggagatccagcaccccaacgtcatcaccctgcac
gaggtttatgagaacaagacggacgtcatcctgatcctggaactcgttgcaggtggcgag
ctgtttgacttcttagctgaaaaggaatctttgactgaagaggaagcaaccgaatttctc
aaacaaatccttaatggtgtttactacctgcactcccttcagattgcccactttgatctt
aagcccgaaaacataatgcttctggatagaaatgttcccaaacctcggattaagatcatc
gactttgggttggctcataaaattgactttggcaatgaattcaaaaacatatttgggaca
ccagaatttgttgctcccgagatagtcaactatgaacctctgggtcttgaggcagacatg
tggagtattggggtaataacctacattctcctaagtggggcctccccatttcttggagac
actaagcaagaaacgttagcaaatgtatctgccgtcaactacgaatttgaggaagagtac
ttcagtaacaccagcgccctagccaaagattttataagaagactcctcgtcaaggatcca
aagaagagaatgacaattcaagatagtttgcagcatccttggatcaagcctaaagacact
caacaagcccttagtagaaaagcatcggcagtaaacatggagaaattcaagaagttcgcg
gcccggaaaaaatggaaacaatccgttcgcttgatatcactgtgccaaagattatccagg
tcattcttgtccagaagtaacatgagtgttgccagaagcgatgatactctggacgaggaa
gactcctttgtgatgaaggctatcgtccacgccatcaacgatgacaacgtcccaggcctg
cagcacctcctgggctccttgtccagctatgatgtcaaccagcccaacaagcatgggaca
cctccgttacttattgctgctggctgtgggaatattcagatactacagttgctcattaaa
agaggctcaagaatcgatgttcaggacaagggtggatccaatgccatctactgggcttct
cggcatggccatgtagataccctgaaatttctccatgagaacaaatgccctttggatgtg
aaagacaagtctggagagacagcccttcatgtggcagctcgctacggccacgccgatgtg
gttcagttactgtgcagcttcggctcgaaccctaacttccaggacaaggaagaagaaacc
cccctgcactgtgccgcctggcacggctattactctgtggccaaagccctttgtgaaacc
ggctgcaacgtgaacattaagaaccgagaaggggagacgcccctcctgacagcctcagcc
aggggctaccacgacatcgtggagtgtctcgccgaacacggagccgacctgaacgcgtgc
gacaaggatggacacatcgctctgcatcttgctgtaagacgatgccagatggaggtcatc
cacacgctcatcagccagggctgttccgtcgatttccaagaccggcacggcaacacgccc
ctccatgtggcctgcaaagatggcaatgtgccgattgtggtggccctctgtgaagccggc
tgcaatttggatctctccaacaagtatggacggacacctctgcaccttgcagccaacaac
gggattctggacgtggtccgctacctctgtctgacaggcgccaacgtggaggcgctgacc
tcggatggaaagacagcggaagatcttgctaaatcggaacagcacgaacatgtagcaggt
cttctcacaagactccgaaaggacacacaccgaggactcttcatccagcagctgcgaccc
acgcagaacctccagccgagaatcaaactgaagctgttcggccactcagggtctgggaag
accacgctggtggagtctctcaagtgtgggctgctgagaagcttcttccgaagacgcagg
ccccggctctcctccaccaactccacccggttcccgccctcgcccctggcctccaagccc
acagtctccgtgagcatcaacaacctgtacccgggctgcgagaacgtgagcgtcaggagc
cgcagcatgatgttcgagcccggcctcaccaaggggatgctggaggtgttcggggcccct
gcccaccacccgcactgctccgccgatgaccagtccaccaaggccatcgacatccagaac
gcctatctgaacggagttggcgacttcagtgtgtgggagttctctggaaatcctgtgtat
ttctgctgttacgactattttgctgccaatgatcccacgtccatccatgccattgttttc
agtctagaagagccctacgagatccagctgaatcaagtgattttctggctcagtttcctg
aagtctcttgtcccggttgaagaacccatagcctttggcggcaagctaaagaacccgctg
cgagttgtcctggtggccacccatgcagacatcatgaacgtcccccgtccagctggaggc
gagttcggatacgacaaagacacctcgttgctgaaagagatcaggaacaggtttgggaac
gatcttcacatttcaaacaagctgtttgttctggatgctggggcttctgggtcgaaggac
atgaaggtgcttcgaaatcacctgcaggaaatacggagtcagattgtttcggtctgccct
cccatgactcacctgtgtgagaaaatcatctccacgctgccttcctggaggaagctcaac
gggcccaaccagctgatgtcattgcagcagtttgtgtacgatgtgcaggaccaactgaac
cccctggccagcgaggcggacctccggcacatcgcgcagcagctccacagcgtgggcgag
atcaacatcatgcaaagtgaaacggtccaggacgtgctgctcctggacccccgctggctc
tgcaccaacgttctggggaagctgctctccgtggagaccccgcgggccctgcaccattac
cggggccgctacaccatggaggacgtccagcgcctggtgcctgacagcgacgtggaggag
ctgctgcagatcctggatgccatggacatctgcgcccgggacctgagcagcgggactatg
gtggacatccccgccctgatcaagaccgacaacctgcaccgctcctggacggacgaggag
gacgaggtgcgggtctacggcggggtgcgcatcgtccccgtggagcacctcacccccttc
ccctgcggcatctttcacaaggtccaggtgaacctgtgccggtggatccaccagcagagc
gcggagggagacgcggacatccgcctgtgggtgaacggctgcaagatcgccaaccgcggg
gccgagctgctggtgctcctggtcaaccacggccagggcatcgaggtccaggtgcgcggg
ctggagacggaaaagatcaagtgctgcctcctgctggactcggtgtgcagcaccatcgag
aacgtcatggccaccacgctgccggggctgctgacggtgaagcattacctgagcccccag
cagctgagggagcaccacgagcccgtcatggtctaccagccgcgggacttcttccgggcg
cagaccctcaaggagacgtcgctgaccaacaccatgggcggctacaaggagagcttcagc
agcattatgtgcttcggctgtcacgacgtctactcgcaggccagcctgggcatggacatc
cacgcgtcagatctcaacctcctgacccggaggaaactcagtcgcctgctggacccgccc
gatcccatggggaaggactggtgccttcttgccatgaacttgggcctccctgaccttgtg
gcaaagtacaacaccaataatggggctcccaaggagttcctcccgagcccggtccacgcc
ctgctccgagagtggacctcctaccccgagagcacggtcggcatcctcatgtccaaactg
cgggagctggggcgccgggacgcggccgactttctcctgaaggcgtcctcagtgttcaaa
atcaacctcgacggcagtggccaggaggcctacgcctcaagctgcaacagtggcacgtct
tataattccattagctcggtcgtgtcccggtga

DBGET integrated database retrieval system