KEGG   Camelus ferus (Wild Bactrian camel): 102507560
Entry
102507560         CDS       T02979                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr03460  Fanconi anemia pathway
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05216  Thyroid cancer
cfr05217  Basal cell carcinoma
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    102507560 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102507560 (POLK)
   05202 Transcriptional misregulation in cancer
    102507560 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102507560 (POLK)
   05212 Pancreatic cancer
    102507560 (POLK)
   05225 Hepatocellular carcinoma
    102507560 (POLK)
   05226 Gastric cancer
    102507560 (POLK)
   05214 Glioma
    102507560 (POLK)
   05216 Thyroid cancer
    102507560 (POLK)
   05220 Chronic myeloid leukemia
    102507560 (POLK)
   05217 Basal cell carcinoma
    102507560 (POLK)
   05218 Melanoma
    102507560 (POLK)
   05213 Endometrial cancer
    102507560 (POLK)
   05224 Breast cancer
    102507560 (POLK)
   05222 Small cell lung cancer
    102507560 (POLK)
   05223 Non-small cell lung cancer
    102507560 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102507560 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cfr03400]
    102507560 (POLK)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     102507560 (POLK)
DNA repair and recombination proteins [BR:cfr03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    102507560 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 102507560
NCBI-ProteinID: XP_006190121
LinkDB
Position
3
AA seq 878 aa
MDSTKEKSDCTEEKHDSYKDDIMLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNE
LKKEKQVNQRIENMMQQKAQITSQQLRKAQIQADRFAMELEQSRDLNNTIVHIDMDAFYA
AVEMRDNPELKEKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDK
YRAVSREVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRKYFIKTGNSLENDK
PGKEVKLSECERSISPLLFEDSPPDLQSTGNPLQVNSEEPNNPQILQNAIVFGTSAEEVV
KEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQIPPNRQAVMDFIKDLPIRKV
SGIGKVTEKMLKALGIMTCTELYEQRALLFLLFSETSWHYFLHISLGLGSTHLERDGERK
SMSVERTFSEISKAEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTV
SSVVSTAEEIFAIAKELLRTEIDADFPHPLRLRLMGVRLSSFPNEEDKKHQQRSIIGFLQ
PGNQTLSATGCILEKTDKDQFLKPLEMSHKKSFFDKKRSERKWSHQDTFKFETVDKQSLQ
TSQSFQVLKKKMSKNLETLESSDNCQIFTCPVCFKEQGSVSLEAFNKHVDACLDGPSVSG
NSKMSSCSHASSTEVNKIETVHDSVSLCEKQDYETHQRNIEVTPVESVELVETISNSPKT
EDVDAESNKRNKEEGSSLPSKSFNIEYCPQNSSCTVSLENEDVGSLRRQESSQPYLCEVT
SDQALVCPVCNLEQKTSDLTLFNVHVDVCLNKGIIQELRKDKINPVNQPKESTKSAGNSG
KLQKIGTKTKRPGLMTKYSASKKTKPNNPRHTLDVFFK
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggatagcacaaaggaaaagagtgactgcacagaggagaagcatgacagttacaaagat
gatattatgcttaggatgggacttaatgataataaagccggaatggaaggattagacaaa
gaaaaaattaacaagattataatggaagccacaaaggggtccagattttatggaaatgag
ctcaagaaagaaaagcaagtcaaccaacgaatagaaaatatgatgcaacagaaagctcaa
attaccagccaacagctaaggaaagcacagatacaggctgatagatttgcaatggagttg
gaacagagccgggatctgaacaataccatagtgcacattgacatggatgctttctatgca
gctgtagaaatgagggacaatccagaattgaaggaaaaacccattgctgtaggatcaatg
agtatgttgtctacttcaaattaccatgcaagaaggtttggtgttcgtgcagccatgcca
ggatttattgctaaaagactctgcccacaacttattatagtgcccccaaactttgacaaa
taccgagccgtgagtagagaggttaaggaaatacttgctgattatgatcccaattttatg
gccatgagtcttgatgaagcctacttgaatataacaaagcacttagaggaaagacaaaat
tggcctgaggacaaaaggaagtatttcatcaaaacaggaaactctctagaaaatgataaa
cccggaaaggaagttaaactgagtgagtgtgaacgatccatctctccactactttttgaa
gatagtcctcctgatttgcagtccacaggaaatcctctccaagtgaactctgaagaacca
aataatcctcagatactccaaaatgcaattgtttttggaacatcagctgaggaagtagta
aaggaaattcgtttcagaatcgagcaaaaaacaacactgacagccagtgcaggcattgca
ccaaatacaatgttagcaaaagtatgcagtgataagaataaaccgaatggacaataccaa
attccccctaacagacaagctgtgatggacttcatcaaggacttacccattagaaaggtt
tctggaataggaaaagttacagagaaaatgttaaaggccctgggaattatgacttgtaca
gaactctatgaacagagggcgttactctttctccttttctctgaaacatcttggcattat
ttccttcatatctccctgggtctaggttcaacacacctggaaagggatggagagaggaaa
agcatgagtgtcgagaggacattcagtgagataagtaaagcagaggaacagtacagcttg
tgccaagaactttgcagtgaacttgctcaagatctgcagaaagaaggacttaagggcaga
actgttaccattaagctaaagaatgtgaattttgaagtaaaaactcgtgcatctacagtt
tcatctgttgtttctactgcagaagaaatatttgctatcgctaaagaattgctaagaaca
gaaattgatgctgattttccacatcccttgagattaagacttatgggtgtgcggctatct
agttttcccaatgaagaagacaaaaaacaccaacaaaggagcattattggcttcttacag
cctggaaaccaaaccctatcagccactgggtgtatactagagaaaactgacaaagatcag
tttctaaaacctctagaaatgtctcataagaagagtttctttgataaaaagcgatctgaa
aggaaatggagccaccaagacacatttaaatttgaaactgttgataaacagagtttacag
acatcacaatcattccaagttttaaagaagaagatgagtaagaatttagaaacactggag
agttcagataactgtcagatatttacctgtcctgtttgctttaaggagcaaggaagcgtc
agtctggaagcctttaataaacatgtagatgcatgtcttgatggaccttcagtcagtgga
aactctaaaatgtcctcatgttcacatgcttcctccacagaagtgaacaagatagaaact
gtacatgattctgtttcactctgtgagaagcaggattatgaaacccatcagaggaatata
gaggtcaccccagtagaatcggtagagttggtagagaccatcagtaactcacctaaaaca
gaagatgtagatgctgaaagtaataagcgcaacaaagaggaaggttctagtcttccaagc
aaatcgtttaatattgaatactgtcctcagaattcttcttgtactgtttcattggaaaat
gaagatgtcgggtcattaagaaggcaagaatcctcccaaccttacttatgtgaagtgacc
agtgaccaagctctagtttgtcctgtttgtaatctagaacaaaagacatcagatcttacc
ttgttcaatgtgcatgtggatgtttgcttaaataaaggcattatccaggaactgagaaag
gataagattaatccagttaatcaacccaaagaaagcaccaaaagtgctggtaactcagga
aaattacagaagattggaacaaaaacaaaaaggccaggactgatgacgaagtactcagca
tcaaagaaaacaaaaccaaacaatcccagacacacccttgatgtattttttaaatga

DBGET integrated database retrieval system