KEGG   Camelus ferus (Wild Bactrian camel): 102507868
Entry
102507868         CDS       T02979                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4 isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04310  Wnt signaling pathway
cfr04350  TGF-beta signaling pathway
cfr04371  Apelin signaling pathway
cfr04390  Hippo signaling pathway
cfr04520  Adherens junction
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04659  Th17 cell differentiation
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05161  Hepatitis B
cfr05166  Human T-cell leukemia virus 1 infection
cfr05200  Pathways in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05220  Chronic myeloid leukemia
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102507868 (SMAD4)
   04350 TGF-beta signaling pathway
    102507868 (SMAD4)
   04390 Hippo signaling pathway
    102507868 (SMAD4)
   04371 Apelin signaling pathway
    102507868 (SMAD4)
   04068 FoxO signaling pathway
    102507868 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102507868 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102507868 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    102507868 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102507868 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102507868 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102507868 (SMAD4)
   05212 Pancreatic cancer
    102507868 (SMAD4)
   05225 Hepatocellular carcinoma
    102507868 (SMAD4)
   05226 Gastric cancer
    102507868 (SMAD4)
   05220 Chronic myeloid leukemia
    102507868 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102507868 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102507868 (SMAD4)
   05161 Hepatitis B
    102507868 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102507868
NCBI-ProteinID: XP_032326318
LinkDB
Position
30
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaacacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcaccctagcaaatgtgttaccatacagagaacattggatgga
aggcttcaggtggctggtcggaaaggatttccccatgtgatctatgcccgtctttggagg
tggcctgatcttcacaaaaacgaattaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccgtatcactatgaacgagttgtgtcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacggagacatacagcaccccagctttg
ttagctccatcggagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttctaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaagtaggagagacatttaag
gttccttcaagctgtcctatcgttactgttgatggatatgtggacccttctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgatcacgcagtctttgtacagagctactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagcgcatatataaaggtctttgatttg
cgtcagtgtcatcgtcagatgcagcagcaggcggccacagcgcaggctgcagcggctgcc
caggcagcagccgtggcgggaaacatccccggcccaggatcagtaggtggaatagcccca
gctatcagtttgtcagccgctgctgggatcggtgtcgatgacctccgtcgcttatgcata
ctcaggatgagctttgtgaaaggctggggacctgattacccgagacagagcatcaaggaa
acaccttgctggattgagattcacttacaccgggccctccagctcctagatgaagtgctt
cacaccatgcctattgctgacccacagcctttagactga

DBGET integrated database retrieval system