KEGG   Camelus ferus (Wild Bactrian camel): 102508062Help
Entry
102508062         CDS       T02979                                 

Gene name
ITGAV
Definition
(RefSeq) integrin subunit alpha V
  KO
K06487  integrin alpha V
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04145  Phagosome
cfr04151  PI3K-Akt signaling pathway
cfr04510  Focal adhesion
cfr04512  ECM-receptor interaction
cfr04514  Cell adhesion molecules (CAMs)
cfr04810  Regulation of actin cytoskeleton
cfr04919  Thyroid hormone signaling pathway
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05222  Small cell lung cancer
cfr05410  Hypertrophic cardiomyopathy (HCM)
cfr05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cfr05414  Dilated cardiomyopathy (DCM)
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102508062 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102508062 (ITGAV)
   04514 Cell adhesion molecules (CAMs)
    102508062 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102508062 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102508062 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102508062 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102508062 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102508062 (ITGAV)
   05205 Proteoglycans in cancer
    102508062 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102508062 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102508062 (ITGAV)
   05410 Hypertrophic cardiomyopathy (HCM)
    102508062 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102508062 (ITGAV)
   05414 Dilated cardiomyopathy (DCM)
    102508062 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102508062 (ITGAV)
   05165 Human papillomavirus infection
    102508062 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102508062 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102508062 (ITGAV)
   04515 Cell adhesion molecules [BR:cfr04515]
    102508062 (ITGAV)
   04090 CD molecules [BR:cfr04090]
    102508062 (ITGAV)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102508062 (ITGAV)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102508062 (ITGAV)
  Exosomal proteins of epithelial cells
   102508062 (ITGAV)
Cell adhesion molecules [BR:cfr04515]
 Integrins
  Integrin alpha subunits
   102508062 (ITGAV)
CD molecules [BR:cfr04090]
 Proteins
  102508062 (ITGAV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 102508062
NCBI-ProteinID: XP_006189302
LinkDB All DBs
Position
Un
AA seq 985 aa AA seqDB search
MFLLVGAPKANTTQPGIVEGGQVLKCDWSSQRGCQPIEFDATGNRDYAKDDPLEFKSHQW
FGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDADGQG
FCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPKVYSIKYNNQLATRTA
QAIFDDSYLGYSVAVGDFNGDGVDDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGEQMA
AYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNG
FEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRPTGLNAVPSQILEG
KWAARSMPPSFGYSMKGATDIDRNGYPDLIVGAFGVDRAVLYRARPVITVNAGLEVYPSI
LNQDNKTCPLPGTELKVSCFNVRFCLKADGKGALPMKLNFQVELLLDKLKQKGAIRRALF
LHNRSPGHSKNMTISRGGQMQCEELIAYLRDESEFRDKLTPITIFMEYWLDYRTAADATG
LQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQN
QGEGAYEAELIVSIPPQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAGTQL
LAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHRVDLAVLAAVEIRGVSSPDHI
FLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLNLQWPYKYNNNTLLYILQ
YDIDGPMNCTSDMEINPLRIKISNLQTTEKNDTFGGQGDRNHLITKRDLTPSDGDVHTLG
CGIAECLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPY
KNLPIEDLFNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKR
VRPPQEEQEREQLQPHENGEGNSET
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttctggtgggggcgcccaaagcgaacactacccagcccgggattgtggaagga
gggcaggtcctcaagtgtgactggtcttctcagcgggggtgccagccaattgaatttgat
gcaacaggcaatagagattatgccaaggatgatccattggagttcaagtcccatcagtgg
tttggagcatctgtgaggtcaaaacaggataaaattttggcctgtgcccccctgtaccac
tggaggacggaaatgaaacaggagagagaacctgttggaacatgctttcttcaggatgga
acaaagactgttgagtatgctccatgcagatcaaaaaatattgatgctgatggacaggga
ttttgtcaaggaggattcagcattgattttactaaagctgacagagtacttcttggtggt
cctggtagcttttattggcaaggtcagctcatttcggatcaagtagcagaaattgtatct
aaatatgaccctaaagtttacagcatcaagtataataaccagttagcaactcggactgca
caagcaatttttgatgacagttatttgggttactcagtggccgtcggagatttcaacggt
gatggcgtagatgactttgtttcaggagttccgagagcagcgaggactttggggatggtg
tatatttatgacgggaaaaacatgtcctctttacataattttactggtgagcagatggct
gcatattttggattttctgtcgctgccactgacattaatggggatgattacgcagatgtg
tttattggcgcacctctcttcatggatcgtggttctgacggcaaactccaggaggtgggg
caggtctcagtgtctctgcaaagagcttcgggagacttccagacgaccaagctgaatggg
tttgaggtttttgcaaggttcggcagtgccatagctcctttgggagatctggaccaggac
ggcttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaaggaattgtt
tatattttcaacggaagacccacaggcttgaatgcggtcccgtctcagatcctcgaagga
aagtgggctgcccggagcatgccaccgagcttcggctattccatgaaaggagccacggac
atagacaggaacggatatccagatttaattgtaggggcttttggtgtggatagagctgta
ttatacagggccagaccagttatcactgtaaacgctggccttgaagtgtaccctagcatt
ttaaatcaagacaataaaacctgcccactgcctgggacagagctcaaagtttcctgtttt
aatgtcaggttctgcttaaaggcagatggcaaaggagcacttcccatgaaacttaacttc
caggtggagcttcttttggataaactcaagcaaaaaggagcaattcgacgagcactgttt
ctccataacaggtccccgggtcactccaagaacatgaccatttcacgagggggacagatg
cagtgtgaggagctgatagcatatctgcgggatgaatctgaatttagagacaagctcact
ccgattacaatttttatggagtattggttggattacagaacggctgctgatgcaacaggc
ttgcaacccattcttaaccagttcactcctgccaacgtcagtcgacaggctcatattcta
cttgactgtggtgaagacaatgtctgtaaacccaaactggaagtttctgtagatagtgat
caaaagaagatctatattggggacgacaaccctctgaccttgattgttaaggcccagaat
caaggagaaggtgcctatgaagctgagctcattgtttccatcccgccgcaggctgacttc
attggggttgtccgcaacagtgaagccttagcgagactgtcctgtgcatttaagacagaa
aaccaaacccgccaggttgtatgtgaccttggaaacccaatgaaggctggaactcaactt
ttagctggtcttcgtttcagtgtgcaccagcaatcagagatggatacttctgtgaaattt
gatttacaaatccaaagctccaatctctttgacaaagtaagcccagttgtatctcacaga
gttgaccttgctgttttagctgctgttgagataagaggagtctcaagtcctgatcatatc
tttcttccgattccaaactgggagcacaaggagaaccctgagaccgaagaagatgttggc
ccagtagttcagcacatctatgagctgagaaacaacggtccaagttcattcagcaaggca
atgctaaatcttcagtggccttacaaatataacaataacactttgttgtacatccttcaa
tatgacatcgatgggccaatgaactgcacttcagatatggagatcaaccctttgagaatt
aagatctcaaatttgcaaacaacggaaaagaatgacacatttggtgggcagggtgaccgg
aaccatctcatcactaagcgggatctcacccccagtgacggagatgttcacactttgggc
tgtggaattgctgaatgcttgaagattgtctgccaggtggggcgactagacagaggaaag
agtgcgatcctgtatgtaaagtctctgctgtggactgagacctttatgaataaggaaaac
cagaatcactcatattctctgaagtcatctgcttcattcaatgtcatagagtttccttat
aagaaccttccaattgaggacctcttcaactctacattagttaccactaatgtcacctgg
ggcattcagccagcacccatgcctgtgcctgtgtgggtgatcattttagcagttctagca
ggattgttgttactggctgttttggtatttgtcatgtacaggatgggcttttttaaacgt
gtccggccgcctcaagaagaacaagaaagggaacagcttcagcctcatgaaaatggggaa
ggaaactcagaaacttaa

KEGG   Camelus ferus (Wild Bactrian camel): 102524464Help
Entry
102524464         CDS       T02979                                 

Gene name
ITGB5
Definition
(RefSeq) integrin subunit beta 5
  KO
K06588  integrin beta 5
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04145  Phagosome
cfr04151  PI3K-Akt signaling pathway
cfr04510  Focal adhesion
cfr04512  ECM-receptor interaction
cfr04810  Regulation of actin cytoskeleton
cfr05165  Human papillomavirus infection
cfr05205  Proteoglycans in cancer
cfr05410  Hypertrophic cardiomyopathy (HCM)
cfr05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cfr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102524464 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102524464 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102524464 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102524464 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102524464 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102524464 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102524464 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102524464 (ITGB5)
   05414 Dilated cardiomyopathy (DCM)
    102524464 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102524464 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102524464 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cfr04515]
    102524464 (ITGB5)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    102524464 (ITGB5)
Cell adhesion molecules [BR:cfr04515]
 Integrins
  Integrin beta subunits
   102524464 (ITGB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2 I-EGF_1 DUF2975
Motif
Other DBs
NCBI-GeneID: 102524464
NCBI-ProteinID: XP_014419087
LinkDB All DBs
Position
Un
AA seq 792 aa AA seqDB search
MTQNVMDSECPFHLQGLNICTSGSATSCEECLLIHPKCAWCSKENFGSLRSVTSRCDLRA
NLVRNSCGGEFESPVSSTQVLRSQPLSSKGSSPVGSDVIQMTPQEVTVNLRPGEQTTFQL
QVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKNIS
PFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEG
GFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEY
TASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILHGDSKNII
QLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSV
EARSCPGKHTQHTFTLRPVGFRDSLEVGVTYNCRCSCSEVLEPDSARCSGNGTYVCGLCE
CNPSYLGTRCECQEGESQSGYQNLCREAEGKPLCSGRGQCSCNQCSCFESEFGKIYGPFC
ECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCQARDGQICSDRGHC
VCGQCQCTEPGAFGETCEKCPTCPDACSTKRDCVECLLLHSGSSADNQTCQNLCKDEVIT
RVDTIVKDDQEAVLCFYKTAKDCVMMFTYTELPSGKSNLTVLREPECGTAPNAMTILLVV
VGSILLVGIALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTF
NKFNKSYNGTVD
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaacgtcatggacagcgagtgcccctttcacctccaaggtctgaacatatgc
actagtggaagtgccacctcgtgtgaagaatgtctgctgatccacccaaaatgtgcctgg
tgctccaaagagaacttcggcagcctgcggtcggtcacctcccgctgtgatctgagggcc
aacctggtcaggaacagctgtggtggcgagttcgagagcccagtcagcagcacccaggtc
ctgcggagccagcctctcagcagcaagggctccagccccgtggggtccgatgtcatccag
atgacgccgcaggaggtcacggtgaacctgcggcctggtgagcagacgaccttccagctg
caggttcgtcaggtggaggattatcctgtggacctgtactacctgatggacctctctctg
tccatgaaggatgacttggacaacatccgcagcctgggcaccaagctggccgaggagatg
aggaagctcaccagcaacttccggctggggttcgggtcttttgtagacaagaacatctct
cctttctcctacacagcaccgaggtaccagaccaacccctgcattggttacaagttattc
cccaactgtgtcccctcctttgggttccgccatctgctgcctctcacagacagagtcgac
agtttcaatgaggaagttcggaaacagagggtgtcccggaaccgcgatgccccggagggt
ggctttgacgcggtgctccaggcggctgtctgcaaggagaagatcggctggcgaaaggat
gcgctgcacttgctggtgttcacaacggatgacgtgccccacattgcgctggatggaaaa
ctggggggccttgtgcagccgcacgatggccagtgccacctgaatgaggccaacgagtac
actgcgtccaaccagatggactatccatcgcttgccttgcttggagagaaactggcagag
aacaacatcaacctcatctttgcagtgacaaaaaaccattatatgctctacaagaatttt
acagccctgatacctggaacaacagtggagattttacatggagactccaaaaatattatt
caactgatcatcaatgcatacaatagcatccggtctaaagtggaactgtccgtgtgggat
cagcctgaggatcttaatctcttcttcactgctacctgccaggatggcgtctcctaccct
ggtcagaggaagtgtgaaggcctaaagattggggacacggcgtcctttgaggtgtcagtg
gaggcccggagctgcccaggcaaacacacgcagcacacgttcaccctgcggcccgtggga
ttccgggacagcctggaggtgggggtcacctacaactgcaggtgcagctgcagcgaggtg
ctggagcccgacagcgccaggtgcagcgggaacgggacttacgtctgcggcctgtgtgag
tgcaaccccagctacttgggcaccaggtgcgagtgccaggaaggggagagccagagcggg
taccagaacctgtgccgcgaagcggagggcaagcccctgtgcagcgggcgcgggcagtgc
agctgcaaccagtgctcctgctttgagagcgagttcggcaagatctacgggcccttctgt
gagtgcgacaacttctcctgtgccaggaacaaaggcgtcctctgctcaggccacggcgag
tgtcactgcggagaatgcaagtgccacgcaggctacatcggggacaactgtaactgctcg
acagacatcagcacgtgccaggccagggatggccagatctgcagcgaccgcgggcactgc
gtctgcgggcagtgccagtgcactgagccaggagccttcggggagacgtgtgagaagtgc
ccgacctgccccgatgcttgcagcaccaagagagattgtgtggaatgcttgctgcttcac
tcagggagctcagctgacaaccagacttgccaaaacctgtgcaaggatgaggtgatcacg
cgggtggacaccatcgtgaaagatgaccaggaggctgtgctctgtttctacaaaactgcc
aaggattgtgtgatgatgttcacctacacagagctccccagtgggaagtccaacctgacg
gtcctcagggagccagagtgtggaaccgcccccaatgccatgaccatcctcctggttgtg
gttggcagcatcctcctggttgggattgcgctcctggccatctggaagctgctcgtcacc
atccacgaccggagagagtttgcaaagttccagagcgagcgatcccgggcccgctacgaa
atggcctcgaaccctctgtacagaaagcccatctccacacacaccgtggacttcaccttc
aacaagttcaacaaatcctacaacggcacagtggactga

DBGET integrated database retrieval system