KEGG   Camelus ferus (Wild Bactrian camel): 102508180
Entry
102508180         CDS       T02979                                 

Gene name
SGK2
Definition
(RefSeq) serine/threonine-protein kinase Sgk2
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04068  FoxO signaling pathway
cfr04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102508180 (SGK2)
   04151 PI3K-Akt signaling pathway
    102508180 (SGK2)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102508180 (SGK2)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   102508180 (SGK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo
Other DBs
NCBI-GeneID: 102508180
NCBI-ProteinID: XP_006193550
LinkDB
Position
19
AA seq 367 aa
MDSSPAGTPSPQPPRANGNINLGPSANPNARPTDFDFLKIIGKGNYGKVLLAKRKSDGTF
YAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGE
LFFHLQREHRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGL
CKEGVEPEETTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDLS
QMYENILHQPLQIPGGRTVAACDLLQALLHKDQRQRLGSKTDFLEIKSHVFFSPINWDDL
YHKRLTPPFNPNVAGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE
DDAILDC
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggactctagcccagctgggacccccagtccgcagcccccaagggccaatgggaatatc
aacctggggccttctgccaacccaaatgcccggcccaccgacttcgatttcctcaaaatc
attggcaaaggaaactacgggaaggtcctactggccaagcgcaagtctgacgggacgttc
tatgcagtgaaggtgctgcagaaaaaatccatcttaaagaagaaagagcaaagccacatc
atggcggagcgcagcgtgctcctgaagaacgtgcggcaccccttcctcgtgggcctgcgc
tactccttccagacgcccgagaagctctactttgtgctcgactatgtcaacgggggagag
ctcttcttccacctgcagcgggagcaccggttcctggagccccgggctcggttctacgcc
gccgaggtggccagcgccattggctacctgcattctctcaacatcatttacagggacctg
aaaccagagaacattctcttggactgccagggacacgtggtgctgacagattttggcctc
tgcaaggaaggtgtagagcccgaggagaccacgtccacgttttgtggcacccctgagtac
ttggctccagaagtgcttcggaaagagccttatgatcgggcagtggactggtggtgcttg
ggggcggttctctacgagatgctgcatggcctgccgcccttctacagccaagacctgtcc
cagatgtacgagaacattctgcaccagccgctgcagatccctgggggccggacggtggcc
gcctgtgacctcctgcaagcccttctccacaaggaccagaggcagcggctgggctctaag
acagactttcttgagataaagagccatgtattcttcagccccataaactgggatgacttg
taccacaagaggctgactccacccttcaacccaaatgtggcaggacctgctgacttgaaa
cactttgacccagagttcacccaagaagctgtgtcaaagtccattggctgcactcccgac
actgtggccagcagctctggggcctcaagtgccttcctgggattttcctatgcgccggag
gatgatgccatcctggattgctag

KEGG   Camelus ferus (Wild Bactrian camel): 102511863
Entry
102511863         CDS       T02979                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3 isoform X1
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04068  FoxO signaling pathway
cfr04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102511863
   04151 PI3K-Akt signaling pathway
    102511863
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102511863
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   102511863
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PX Pkinase_C Kinase-like FTA2 Kdo APH
Other DBs
NCBI-GeneID: 102511863
NCBI-ProteinID: XP_006193804
LinkDB
Position
29
AA seq 490 aa
MDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLRKQFP
AMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRHPELYNHPDVRAFLQMDSPKHQS
DPSEDEDERSTQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGK
FYAVKVLQKKVVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGG
ELFFHLQRERSFPEQRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFG
LCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDV
AEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWTD
LVQKKIPPPFNPNVAGPDDIRNFDAAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFS
YAPPSEDLFL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggactacaaggaaagctgcccaagtgtcagcattcccagctctgatgaacacagagag
aaaaagaagaggtttactgtttataaagttctggtctcagtgggcaggagtgagtggttt
gtcttcaggagatatgcagagtttgacaagctttacaatactttgagaaaacaatttcct
gctatggccctgaagattcctgccaagagaatatttggtgataattttgatccagatttt
attaagcaaagaagagcaggactgaatgaattcattcagaacttagttaggcatccagag
ctttacaaccatccagatgtcagagcattccttcaaatggacagtccaaaacatcagtca
gatccatctgaagatgaggatgaaagaagtactcagaagctacattctacctcacagaac
atcaacctgggaccatctggaaatcctcatgctaaaccaacagactttgatttcttaaaa
gttattggaaaaggcagctttggcaaggttcttcttgcaaaacggaaactggatggaaaa
ttctatgctgtcaaagtgttacagaaaaaagtcgttctcaacagaaaagagcaaaaacac
attatggctgaacgtaatgtgctcttgaaaaatgtgaaacatccatttttggttggatta
cattattctttccaaacaactgaaaagctttattttgttctggattttgttaatggaggg
gagctgttttttcacttacaaagagaacggtcctttcctgaacaaagagctaggttttat
gctgctgaaattgccagtgctttgggctacttgcactccatcaaaatagtgtacagagac
ttgaaaccagaaaatattcttctggattcagtaggacatgttgtcttaacagattttggg
ctttgtaaagaaggaattgctatttctgacaccacaacaacattttgtgggacaccagag
taccttgcacccgaagtgatcagaaaacagccctatgacaatactgtagattggtggtgc
ctgggtgctgttctgtatgaaatgctgtatggattgcctcctttttattgccgagatgtg
gctgaaatgtatgacaatattcttcacaagcccctaagtttgaggccaggagtgagcctc
acagcctggtccattctggaagaactcctagaaaaagacaggcaaaaccgactcggtgcc
aaagaagactttcttgaaattcagaatcatcccttttttgaatcactcagctggactgat
cttgtacaaaagaagattccaccaccgtttaatcctaatgtggcaggaccagatgacatc
aggaactttgatgcagcatttacagaagaaacagttccatattccgtgtgtgtgtcttct
gactattccatagtgaacgccagtgtcctggaagcagatgatgcatttgttggtttctct
tacgcacctccttcagaagacttatttttgtga

KEGG   Camelus ferus (Wild Bactrian camel): 102516719
Entry
102516719         CDS       T02979                                 

Gene name
SGK1
Definition
(RefSeq) serine/threonine-protein kinase Sgk1 isoform X2
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04068  FoxO signaling pathway
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102516719 (SGK1)
   04151 PI3K-Akt signaling pathway
    102516719 (SGK1)
   04150 mTOR signaling pathway
    102516719 (SGK1)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102516719 (SGK1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102516719 (SGK1)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   102516719 (SGK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like PX Kdo
Other DBs
NCBI-GeneID: 102516719
NCBI-ProteinID: XP_006188519
LinkDB
Position
8
AA seq 526 aa
MVNKDMNGFPVKKCSAFQFFKKRVRRWIKSPMVSVDKHQSPSLKYSGPSVVHIPPGEPDF
EPSLCQTCLGDHAFQRGVLPPEKESCSWETQSGCEVKEPSNHANILTKPDPRTFWTNDDS
AFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINL
GPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEAFYAVKVLQKKAILKKKEEKHIMS
ERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAE
IASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNGTTSTFCGTPEYLA
PEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSAR
HVLEGLLQKDRTKRLGAKDDFMEIKNHVFFSLINWDDLINKKITPPFNPNVSGPSDLRHF
DPEFTEEPVPNSIGRSPDSILLTASVKEAAEAFLGFSYAPPVDSFL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggtaaacaaagacatgaatggattcccagtcaagaagtgctcagccttccagtttttt
aagaagcgggtacgaagatggatcaagagcccaatggtcagtgtggacaagcatcagagt
cccagcctgaagtactcgggcccctcagtggtccacatcccaccaggagagccagacttc
gagccttccttgtgtcagacgtgcctgggagaccacgctttccaaagaggggttctccct
ccggagaaggagtcatgctcatgggaaactcaatccgggtgtgaagtaaaagagccaagt
aaccatgccaacatcctgaccaagcctgacccaagaaccttctggactaatgatgattca
gctttcatgaaacagagaaggatgggcctgaacgactttattcagaagattgccaataac
tcctatgcatgcaaacaccctgaagttcagtccattctgaaaatctcccagcctcaggaa
cctgagcttatgaatgccaacccttctcctccgccaagtccttctcagcaaatcaacctt
ggcccatcatccaatcctcatgctaaaccatctgactttcacttcttgaaagtgattggg
aagggcagttttggaaaggttcttctagcaagacacaaagcagaagaagcattctatgca
gtcaaagttttacagaagaaagcaatcctgaaaaagaaggaggaaaagcatattatgtcc
gagcggaatgtcctactgaagaatgtgaaacaccctttcctggtgggccttcacttctct
ttccagactgctgacaaattgtactttgtcctcgactacattaatggtggagagttgttc
taccatctccagagggagcgttgcttcctggaaccacgggcccggttctatgctgctgaa
atagccagtgccttgggttacctgcactctctgaacatcgtttatagagacttgaaacca
gaaaatattttgctagattcgcagggacacattgtccttactgacttcggactctgcaag
gagaacattgaacacaatggcacaacatccactttctgcggcacccctgagtatcttgca
cctgaggtgcttcataagcagccttatgacaggaccgtggactggtggtgcctgggggcc
gtcttatatgagatgctctatggcctgcctcccttttatagccgaaacacagctgagatg
tacgacaacattctgaacaagcccctccagttgaagccaaatattacaaactctgcaaga
cacgtcctagagggcctcctgcagaaggacaggacgaagaggctgggtgccaaggatgac
tttatggagattaagaatcacgtcttcttctccctcattaactgggatgatctcattaat
aagaagattactcccccttttaacccaaatgtgagtggacccagtgacctacggcacttt
gaccccgagttcactgaagagccggtccccaactccatcggccggtctcccgacagcatc
ctcctcacagccagtgtcaaggaggcggccgaggccttcctgggcttttcctatgcgccc
cctgtggactctttcctctga

DBGET integrated database retrieval system